KEGG   Mycobacterium liflandii: MULP_04762Help
Entry
MULP_04762        CDS       T02444                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mli  Mycobacterium liflandii
Pathway
mli00071  Fatty acid degradation
mli00072  Synthesis and degradation of ketone bodies
mli00280  Valine, leucine and isoleucine degradation
mli00310  Lysine degradation
mli00362  Benzoate degradation
mli00380  Tryptophan metabolism
mli00620  Pyruvate metabolism
mli00630  Glyoxylate and dicarboxylate metabolism
mli00640  Propanoate metabolism
mli00650  Butanoate metabolism
mli00900  Terpenoid backbone biosynthesis
mli01100  Metabolic pathways
mli01110  Biosynthesis of secondary metabolites
mli01120  Microbial metabolism in diverse environments
mli01130  Biosynthesis of antibiotics
mli01200  Carbon metabolism
mli01212  Fatty acid metabolism
mli02020  Two-component system
Module
mli_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MULP_04762
   00630 Glyoxylate and dicarboxylate metabolism
    MULP_04762
   00640 Propanoate metabolism
    MULP_04762
   00650 Butanoate metabolism
    MULP_04762
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MULP_04762
   00072 Synthesis and degradation of ketone bodies
    MULP_04762
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MULP_04762
   00310 Lysine degradation
    MULP_04762
   00380 Tryptophan metabolism
    MULP_04762
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MULP_04762
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MULP_04762
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MULP_04762
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mli04147]
    MULP_04762
Enzymes [BR:mli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MULP_04762
Exosome [BR:mli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MULP_04762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGC64270
UniProt: L7VCJ3
Position
complement(5184019..5185539)
Genome map
AA seq 506 aa AA seqDB search
MDLDPGTPVIVGVGQAVERIDDPDYQGMSAVELAAAAAQAALEDFAADVAAAIDTVAGVR
QFEISGPVPKAPLGRSNNYPRSVAQRIGADPARAILEIVGGQGPQHLITELAGAIAAGSS
EVAMVFGSDATSTSRHFAGRADKPDFTEIVDGELQDRGPGIDGLITRYTIIHGLVDAPTQ
YGLLENARRAATGLGPADYLRRMGELFAPFTKIAAGNPFAAAPIERTVEELITVTDRNRM
IAEPYPRLLVARDQVNQGAAALVMSVAAARRLGVPEEKWVYLRGHADLQEQALLQRPDLG
HAPSAVLAAREALRVAGVGVDDIATFDLYSCFPVPVFNICDGLGIATDDPRGLTLTGGLP
FFGGAGNNYSMHAVAETVARMRSEPGRFGLVGANGGIMSKYSVGVYSTAPAQWQPDRSAE
LQTQIDSGASRPVTEQADGPATIETYTVRHDGGRLTGIVIGRLAADGRRFLASTEDDELI
GLLTDGDPLGQAIRVRSFDYGNRCVL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgatccgggtacgccggtcattgtcggtgtcggacaggctgtcgaacgcatc
gatgaccccgactaccaggggatgtcggccgttgagctggccgccgccgctgcccaggcc
gctctcgaagactttgcggccgacgtggccgcggccatcgacaccgtcgcgggcgtccga
cagttcgagatctccgggcccgtccccaaggccccgttaggccggtccaacaactatccg
cgctcggtggcccagcggatcggggcggatccggcccgcgcgatcctcgagatcgtcggc
ggccaggggccccagcacctgatcaccgagctggccggcgcgatcgcggcaggcagctcc
gaagtcgcgatggtgttcggctctgatgcgacgtcgaccagtcgtcacttcgctgggcgt
gccgacaaaccggacttcaccgaaatcgtcgacggggagctgcaagaccgcggccctggc
atcgacggcctgatcacgcgctacacgatcattcacggcctggtggatgcgcccacccaa
tacggcttgctggagaatgcccgccgggccgcaacgggcctcggcccggccgactacctg
cggcggatgggcgagctgttcgcgccgttcaccaagatcgcggccggcaatccttttgcc
gcggcgccaatcgagcgcaccgtcgaggagctgatcacggtcaccgaccgtaatcggatg
atcgccgagccctacccccggctgctggtcgcgcgcgatcaggtgaaccagggcgcggcc
gcgctggtgatgtcggttgcggccgcacgccggctcggggttcccgaggaaaagtgggtc
taccttcgcgggcatgccgacctgcaagagcaggccctgctgcagcgccccgatcttggg
cacgccccgtcagccgtgctggcggcgcgcgaggcgctccgggtggccggtgtcggtgtc
gacgacatcgccaccttcgacctgtacagctgctttccggtgccggtgttcaacatctgc
gacggtctggggattgcgaccgatgacccgcgcggtctgacgctcaccggtgggctgccg
ttcttcggcggggcgggaaacaactactcgatgcatgcggtggccgagaccgtagcccga
atgcgtagcgagccgggacggttcgggctcgtcggcgccaacggcgggatcatgagcaag
tactcggtcggggtctattccactgccccggcgcaatggcagccggaccgcagcgccgag
ctgcaaacacaaatcgacagcggggccagccgaccggttaccgaacaggccgacggcccc
gccacgatcgagacgtacacggtccgccatgacggtgggcgtctcaccgggatcgtcatc
ggccggctggccgccgacggccgccgcttcctggcgagcaccgaagacgacgagctgatc
gggttgctgaccgacggcgacccgctggggcaagcgatccgggtgcgctcgttcgactac
ggcaaccgctgcgttctctag

DBGET integrated database retrieval system