KEGG   Mycobacterium liflandii: MULP_05303Help
Entry
MULP_05303        CDS       T02444                                 

Gene name
fadA6_1
Definition
(GenBank) acetyl-CoA acetyltransferase FadA6_1
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mli  Mycobacterium liflandii
Pathway
mli00071  Fatty acid degradation
mli00072  Synthesis and degradation of ketone bodies
mli00280  Valine, leucine and isoleucine degradation
mli00310  Lysine degradation
mli00362  Benzoate degradation
mli00380  Tryptophan metabolism
mli00620  Pyruvate metabolism
mli00630  Glyoxylate and dicarboxylate metabolism
mli00640  Propanoate metabolism
mli00650  Butanoate metabolism
mli00900  Terpenoid backbone biosynthesis
mli01100  Metabolic pathways
mli01110  Biosynthesis of secondary metabolites
mli01120  Microbial metabolism in diverse environments
mli01130  Biosynthesis of antibiotics
mli01200  Carbon metabolism
mli01212  Fatty acid metabolism
mli02020  Two-component system
Module
mli_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MULP_05303 (fadA6_1)
   00630 Glyoxylate and dicarboxylate metabolism
    MULP_05303 (fadA6_1)
   00640 Propanoate metabolism
    MULP_05303 (fadA6_1)
   00650 Butanoate metabolism
    MULP_05303 (fadA6_1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MULP_05303 (fadA6_1)
   00072 Synthesis and degradation of ketone bodies
    MULP_05303 (fadA6_1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MULP_05303 (fadA6_1)
   00310 Lysine degradation
    MULP_05303 (fadA6_1)
   00380 Tryptophan metabolism
    MULP_05303 (fadA6_1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MULP_05303 (fadA6_1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MULP_05303 (fadA6_1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MULP_05303 (fadA6_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mli04147]
    MULP_05303 (fadA6_1)
Enzymes [BR:mli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MULP_05303 (fadA6_1)
Exosome [BR:mli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MULP_05303 (fadA6_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGC64738
UniProt: L7VE51
Position
complement(5720778..5721938)
Genome map
AA seq 386 aa AA seqDB search
MPEAYVIDAVRTAVGKRGGALAGVHPVDLGALGWRGLLDRVDVDPAAVDDVIAGCVDAIG
GQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGAQAIMSGTADLIVAGGMQNMS
QIPISSAMIVGEQFGFSSPTNESKQWLHRYGDQEISQFRGSEMIAEKWNLSREEMEQYAL
TSHARAFAAIRGGRFDNEILSVETESGPFRVDEGPRESSLEKMAGLKTLVEGGRLTAAMA
SQISDGASAVLLASEQAVKDHGLTPRARIHHISARAADPVFMLTGPIPATRHALEKTGLS
IDDIATVEINEAFAPVVLAWLKEIKADPEKVNPNGGAIALGHPLGATGAKLFTTMLNELD
RVGGRYGLQTMCEGGGTANVTIIERL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggcgtacgtcatcgacgctgtacgtaccgcggtgggcaagcgtggcggagcg
ttggcgggggtacatcccgtcgacctgggtgccttggggtggcggggactgctggatcga
gttgacgtcgacccggccgcggtcgacgacgtgatcgcgggctgtgtcgatgccatcggc
ggtcaggccggcaatatcgcacggttgtcctggcttgcggcgggatatcccgaagaagtg
ccaggtgtcaccgtggaccgccaatgcggctccagccagcaggcgatctcctttggtgcg
caagcgatcatgtccggaacggccgacctcatcgttgccggtggcatgcagaacatgagc
cagatcccgatctcgtcggcaatgatcgtcggtgaacaattcggctttagctcgccgacc
aacgaatccaagcagtggctgcaccggtacggggatcaggagatctctcagttccgcggt
tcggagatgatcgccgagaagtggaatttgtcgcgtgaagagatggagcagtatgcgctg
accagccacgcgcgtgcgttcgcggcgatcaggggtggccgcttcgataacgaaatcctt
agtgtggaaacggaatccgggcccttccgggtcgacgaagggccgcgcgagtcatcgctg
gagaagatggctggcttgaagaccctggtcgaggggggacggcttaccgccgcgatggcc
agccagatctccgacggtgccagcgcggtgctgctggcttccgaacaggcggtcaaggat
cacggcctgactccgcgcgctcgcatccaccacatcagtgcgcgcgccgccgacccggtg
ttcatgctcaccggccccatcccggcgacccgccatgcgctggaaaagaccggcctgtcc
atcgatgacatcgccacggtagagatcaatgaggcattcgcgccggtggttttggcgtgg
ctcaaggaaatcaaggccgatcccgagaaggtcaaccccaacggcggtgccatcgctctc
ggtcatccgctgggtgccaccggggccaagctgttcaccaccatgctcaatgaactcgac
cgggtcggtgggcgttacgggctacagacgatgtgtgaaggcgggggcaccgccaacgtc
acgatcatcgagcggctatag

DBGET integrated database retrieval system