KEGG   Mycolicibacterium litorale: B1R94_05715Help
Entry
B1R94_05715       CDS       T05032                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
mll  Mycolicibacterium litorale
Brite
KEGG Orthology (KO) [BR:mll00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B1R94_05715
Enzymes [BR:mll01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     B1R94_05715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AQT78865
UniProt: A0A1U9PCN8
Position
1170977..1171783
Genome map
AA seq 268 aa AA seqDB search
MVVCSVAQFAPEEDKAANLASITRLVADAKTRGSDLVVFPEYSMFTVPVMDERFVASAEP
LDGPFVTAISGLAARHGMAIVCGMNEATDAGSHIHNTLLAVDPRGQIVATYRKLHLYDAF
GYTESQLVTPGPIEQPATFLVKDLRFGMQTCYDLRFPEVTRRLIDAGVDAVLMPAEWVPG
PLKEDHWTTLLRARAIENTVYLAAADQCGRAGAGNSMIVDPMGVVVAALGEEEGLATAIL
DPARITRVRTKNPAIHLRRFAVVPAGTS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtatgctccgttgcccagttcgcccccgaggaggacaaggccgccaatctcgcc
tcgatcacacgcctggtcgccgacgcgaagacgcgcggcagcgatctggtcgtcttcccc
gagtactcgatgttcaccgtcccggtgatggacgaacgcttcgtggcctctgctgagccc
ctggacggcccgttcgtcaccgctatctccggccttgccgcgcggcacggcatggcgatc
gtctgtggcatgaacgaggccaccgatgcgggcagccacatccacaacacgctgttagcg
gttgatccgcggggacagatcgtcgcgacataccgaaagctgcacctctacgacgcattc
ggctacaccgaatcacagctcgtcacgccgggcccgatcgagcagccagcgacgttcctg
gtgaaggatctgcgattcgggatgcagacgtgctacgacctgcgcttccccgaggtgaca
cgccggctgatcgacgctggtgtcgatgcggtgttgatgccggccgaatgggttcccgga
cccctgaaagaagaccattggacgacgctgctccgggcccgggcgatcgagaacaccgtg
tacctggcggcagcggatcaatgcggtcgtgcgggtgccggtaacagcatgatcgtggat
ccgatgggcgtggtcgtcgccgcgctgggcgaggaggagggactcgccaccgccattctg
gacccggcacggatcacccgtgtgcgtaccaagaacccggcaattcacttgcggcgcttc
gcagttgtcccagcgggcacctcgtag

DBGET integrated database retrieval system