KEGG   Mycolicibacterium litorale: B1R94_08065Help
Entry
B1R94_08065       CDS       T05032                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mll  Mycolicibacterium litorale
Pathway
mll00071  Fatty acid degradation
mll00072  Synthesis and degradation of ketone bodies
mll00280  Valine, leucine and isoleucine degradation
mll00310  Lysine degradation
mll00362  Benzoate degradation
mll00380  Tryptophan metabolism
mll00620  Pyruvate metabolism
mll00630  Glyoxylate and dicarboxylate metabolism
mll00640  Propanoate metabolism
mll00650  Butanoate metabolism
mll00900  Terpenoid backbone biosynthesis
mll01100  Metabolic pathways
mll01110  Biosynthesis of secondary metabolites
mll01120  Microbial metabolism in diverse environments
mll01130  Biosynthesis of antibiotics
mll01200  Carbon metabolism
mll01212  Fatty acid metabolism
mll02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B1R94_08065
   00630 Glyoxylate and dicarboxylate metabolism
    B1R94_08065
   00640 Propanoate metabolism
    B1R94_08065
   00650 Butanoate metabolism
    B1R94_08065
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B1R94_08065
   00072 Synthesis and degradation of ketone bodies
    B1R94_08065
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B1R94_08065
   00310 Lysine degradation
    B1R94_08065
   00380 Tryptophan metabolism
    B1R94_08065
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B1R94_08065
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B1R94_08065
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B1R94_08065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mll04147]
    B1R94_08065
Enzymes [BR:mll01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B1R94_08065
Exosome [BR:mll04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B1R94_08065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AQT79235
UniProt: A0A1U9PDR6
Position
1698738..1699931
Genome map
AA seq 397 aa AA seqDB search
MTTSVIVAGARTPIGRLMGSLKDFSGSDLGGIAIKAALEKAFPNVEAPASLVEYVIMGQV
LTAGAGQMPARQSAVSAGIGWDVPALSINKMCLSGIDSIALADQLIRAGEFDVVVAGGQE
SMTRAPHLLMNSREGYKYGDVTVLDHMAYDGLHDVFTDQPMGALTEQRNDVDKFTRLEQD
EFAATSHQKAAAAWKDGVFADEVVPVAIPQRKGEPIEFAEDEGIRANTTAESLSGLKPAF
RKDGTITAGSASQISDGGCAVVVMNKAKAQELGLSWLCEIGAHGVVAGPDSTLQSQPANA
IKKAVAREGISIDQLDVIEINEAFAAVALASSRELGVDLDKVNRNGGAIAVGHPIGMSGA
RITLHAALELARRGSGYAVAALCGAGGQGDALILRAG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgtcggtgatcgttgctggagcacgcacacccatcggcaggttgatgggttcg
ctcaaggatttctccggcagcgatctgggcgggatcgcgatcaaggcagccttggagaag
gccttcccgaatgtggaagcgccggcgtcgctggtcgagtacgtgatcatgggccaggtg
ctgaccgccggtgccggacagatgccggcccgccagtcggcggtgtcggccggtatcggt
tgggatgtgcccgcgctgagcatcaacaagatgtgcctgtcgggcatcgattcgatcgcc
ctggccgatcagttgatccgtgccggtgagttcgacgtcgtcgtggccggcggtcaggag
tcgatgacccgggcgccgcatctgctgatgaacagccgcgaaggctacaaatacggcgac
gtgacggtgctcgatcacatggcctatgacggcctgcacgacgtgttcaccgaccagccg
atgggtgcgctgaccgagcagcgcaacgatgtcgacaagttcacccggctcgagcaggac
gagttcgccgcgacctcgcaccagaaggcggccgcggcgtggaaggacggggtcttcgcc
gacgaggtcgtgccggtggcgattccgcagcgcaagggcgaaccgatcgagttcgccgaa
gacgagggcatccgggccaacaccaccgccgaatcgctgtccggtctcaagcccgccttc
cgcaaggacggcacgatcaccgccggctcggcgtctcagatttccgacggcggttgcgcc
gtcgtggtgatgaacaaggccaaagcccaggaactcgggctgagctggctgtgcgagatc
ggtgcgcacggcgtggtggccggcccggattccacgctgcagtcccagcctgccaacgcc
atcaagaaggcggtcgcgcgggagggcatcagcatcgatcagctcgatgttatcgagatc
aacgaggcgttcgccgcggtggcgctggcctcgagtcgtgagctcggcgtggacctggac
aaggtcaaccgcaacggcggggcgatcgcggtgggccatccgatcgggatgtcgggtgcg
cggatcacgctgcacgccgcgctggaactcgcccggcgtgggtcgggctacgccgtggcc
gccctgtgtggcgccggcggccagggcgacgcgctgatcctgcgcgccggctag

DBGET integrated database retrieval system