KEGG   Mycolicibacterium litorale: B1R94_09575Help
Entry
B1R94_09575       CDS       T05032                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mll  Mycolicibacterium litorale
Pathway
mll00230  Purine metabolism
mll00240  Pyrimidine metabolism
mll01100  Metabolic pathways
mll01110  Biosynthesis of secondary metabolites
mll01130  Biosynthesis of antibiotics
Module
mll_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mll_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
mll_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mll00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    B1R94_09575
   00240 Pyrimidine metabolism
    B1R94_09575
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mll04131]
    B1R94_09575
Enzymes [BR:mll01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     B1R94_09575
Membrane trafficking [BR:mll04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    B1R94_09575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AQT79468
UniProt: A0A1U9PEN6
Position
2052983..2053393
Genome map
AA seq 136 aa AA seqDB search
MTERTLVLIKPDGVERRVVGEIISRIERKGLTIAALELKQVGDELARAHYAEHEGKPFFG
SLLEFITSGPVVAAILEGPRAVAAFRQLAGGTDPVEKATPGTIRGDFGLETQFNLVHGSD
SPDSAEREIALWFPGL
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
gtgacggagcggaccctagttctcatcaagccggacggtgtcgagcgacgggtggtcggc
gagatcatcagccgcatcgagcgcaaaggcctcaccatcgccgccctcgagctcaagcag
gtcggcgacgaattggcccgggcgcactacgccgagcatgagggcaagccgttcttcggc
tcgctgctggagttcatcacctccggccccgtggtcgcggccatcctggaaggcccgcgg
gcggtcgcggcgttccgccaactcgccggtggcaccgatccggtggagaaggcgacgcct
ggcacgatccgcggtgacttcggcctcgagacccagttcaatctcgtgcacggctcggac
tcgccggactccgcagagcgtgagatcgcgctctggtttcccgggctctga

DBGET integrated database retrieval system