KEGG   Mycolicibacterium litorale: B1R94_12645Help
Entry
B1R94_12645       CDS       T05032                                 

Definition
(GenBank) hypothetical protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
mll  Mycolicibacterium litorale
Pathway
mll00903  Limonene and pinene degradation
mll00930  Caprolactam degradation
mll01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mll00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B1R94_12645
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    B1R94_12645
Enzymes [BR:mll01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     B1R94_12645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 COesterase Abhydrolase_6 Glyco_trans_4_4 Thioesterase DUF3089
Motif
Other DBs
NCBI-ProteinID: AQT79939
UniProt: A0A1U9PH41
Position
2684776..2685576
Genome map
AA seq 266 aa AA seqDB search
MGTTRKITRFMESRQRRVRGVQETTGAVAGVPVRWFRPARADAGLIFHVHGGAFVAGSSL
AARAHSGLARHHGVELVSVDYRLAPEHPFPAALDDVWAVYAEVARDRPTVIVGESAGGGL
AMSLVRRVLDRGGKAPKGLVTMFPWADLTNSSDSFTRNEHRDLLSREGLSRSALAYAADC
DLRTPLVSPLYGSFADFPPTLIVVGTRDCLLDDSRTVSARMRADGVDATLVEIAGGFHGF
ILLPAPESKVARRRISTFVGTALDHK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaccacgcgcaaaatcacccgattcatggagtcgcgccagcggcgggtgcgtgga
gtccaggagaccaccggcgcggtggcaggtgtacccgtccggtggttccgcccggcccgg
gcggacgcagggttgatcttccacgtacacggtggggcgtttgtggccggtagttcgctg
gcggcccgagcccacagcgggctggcccgtcaccacggcgtggaactggtgagcgtcgat
taccgccttgcgccggaacacccgtttcccgcggctcttgatgatgtgtgggcggtctac
gcggaggtagcgcgcgaccgcccgacggttattgtcggggagtccgccggaggcggactg
gccatgtcgttggtgcgacgagtgctcgaccggggcggtaaggcgccgaaaggtctggtg
acgatgttcccctgggccgatctcaccaacagttccgacagcttcacacggaatgaacac
cgggatctgctgtcccgcgagggactttcacgtagcgcgttggcctatgccgctgactgt
gatctgaggacacctctggtgtcaccgctctacggctcattcgccgactttccccccacg
ctcatcgtcgtcggtacccgcgactgcttgctcgacgactcccgcaccgtctcggcccgc
atgcgtgccgacggcgtcgacgccacgcttgtcgaaatagccggcggattccacggtttc
atcctgttgcccgctccggaatcgaaggtagccaggcgtcgaatatcgaccttcgtaggc
acagccctcgaccacaagtaa

DBGET integrated database retrieval system