KEGG   Mesorhizobium loti NZP2037: A9174_03360Help
Entry
A9174_03360       CDS       T04711                                 

Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00260  Glycine, serine and threonine metabolism
mln00630  Glyoxylate and dicarboxylate metabolism
mln00670  One carbon pool by folate
mln01100  Metabolic pathways
mln01110  Biosynthesis of secondary metabolites
mln01130  Biosynthesis of antibiotics
mln01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A9174_03360
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A9174_03360
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    A9174_03360
Enzymes [BR:mln01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     A9174_03360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: ANN55899
Position
complement(711155..712285)
Genome map
AA seq 376 aa AA seqDB search
MMETFLAERRSPFYSSIVGLGATMGRVGGDFISAKYYSRIADEHLNTRANVGVQDLSTIG
KMDIKGPEAEALVNHVIVNDAAAMKPGQVRYSTVCREDGGIMDDLTVFRLATEHFMLVTG
SVNRLKMLPWLQHHAQGRKAYVTDITAAVAFPTIQGPRSRELLKAMISDADLDGLKRWAF
TSGHVNGTRVLISRTGVTGELGFELFVPADEAASVWDTLMRAGKDFGLKPYGVLAMFTLG
LEKAYPAHGIDMDESRTPFHVGLDRWIKFDKGDFIGREALLKIRDKGLDERWTGLILDGD
KPAATDARILADGEDAGIVTYSDHGYSLGRVLATAHLRLPFTAVGTELSIDINGVPTRAV
VAPMPFFDLEGMRLRG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgatggagaccttcttggctgagcggcgttcccccttctacagcagcatcgtcgggctc
ggcgcgaccatgggtcgggtcggcggcgatttcatctcggccaaatattattcccgcatc
gccgacgagcacctgaacacgcgcgccaatgtcggcgtgcaggatctcagcaccattggc
aagatggacatcaaagggccggaggccgaggcgctggtcaaccatgtcatcgtcaacgac
gcggcggcgatgaagccgggccaggtccgctactccacggtctgccgcgaggatggcggc
atcatggacgacctcaccgtgttccggttggcgactgagcatttcatgctggtcaccggc
tcggtcaaccggctgaagatgctgccctggctgcagcaccatgcccagggccgcaaggcc
tatgtcaccgacatcaccgccgccgtcgccttcccgaccatccagggtccgcgctcgcgc
gaactgttgaaggcgatgatctcggatgccgatctggacggtctcaagcgctgggcgttc
acgtcgggccatgtcaatggcactcgcgtcctgatctcgcgcaccggcgtcaccggcgag
ctcggcttcgaactcttcgtgccggccgacgaggcggcctccgtctgggatacgctgatg
cgggccggcaaggacttcggcctgaaaccctatggcgtgctggcgatgttcacgctcggc
ctggaaaaggcctatccggcgcatggcatcgacatggacgagagccgcacgccgttccat
gtcggcctcgaccgctggatcaagttcgacaagggcgatttcatcggccgcgaagcgctg
ctcaaaatccgcgacaagggcctcgacgagcgctggacgggactgatcctcgacggcgac
aaaccggcggcgacggacgccaggatcctggccgatggcgaggatgccggcatcgtcacc
tacagcgaccacggctactctctcggcagggtgctggccaccgcgcatctgcgcttgccg
ttcacggcggtcggtaccgaactcagcatcgacattaatggcgtgccgacccgcgcggtc
gtggcgccgatgccgtttttcgatctggagggtatgaggttgagggggtag

DBGET integrated database retrieval system