KEGG   Mesorhizobium loti NZP2037: A9174_06595Help
Entry
A9174_06595       CDS       T04711                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00071  Fatty acid degradation
mln00072  Synthesis and degradation of ketone bodies
mln00280  Valine, leucine and isoleucine degradation
mln00310  Lysine degradation
mln00362  Benzoate degradation
mln00380  Tryptophan metabolism
mln00620  Pyruvate metabolism
mln00630  Glyoxylate and dicarboxylate metabolism
mln00640  Propanoate metabolism
mln00650  Butanoate metabolism
mln00900  Terpenoid backbone biosynthesis
mln01100  Metabolic pathways
mln01110  Biosynthesis of secondary metabolites
mln01120  Microbial metabolism in diverse environments
mln01130  Biosynthesis of antibiotics
mln01200  Carbon metabolism
mln01212  Fatty acid metabolism
mln02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9174_06595
   00630 Glyoxylate and dicarboxylate metabolism
    A9174_06595
   00640 Propanoate metabolism
    A9174_06595
   00650 Butanoate metabolism
    A9174_06595
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A9174_06595
   00072 Synthesis and degradation of ketone bodies
    A9174_06595
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A9174_06595
   00310 Lysine degradation
    A9174_06595
   00380 Tryptophan metabolism
    A9174_06595
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A9174_06595
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A9174_06595
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A9174_06595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mln04147]
    A9174_06595
Enzymes [BR:mln01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A9174_06595
Exosome [BR:mln04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A9174_06595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANN61281
Position
complement(1365990..1367174)
Genome map
AA seq 394 aa AA seqDB search
MSSANSIVVASAARTAVGSFNGAFAATPAHELGAVVIKELLSRAGVEAAEVDEVILGQVL
TAAQGQNPARQASIIAGLPKETTAWGLNQVCGSGLRAIALGMQQIATGDAKVIVAGGQES
MSLSPHAEHLRAGVKMGDYKMIDTMIKDGLWDAFNGYHMGNTAENVARQFQITRDDQDQF
ALASQNKAEAAQKAGKFKDEIVAFTIKGRKGDTIVDQDEYIRHGATLDAMTKLKPAFDKD
GSVTAANASGINDGAAGALLMSEAEAARRGITPLVRIASWATAGVDPAIMGTGPIPASRK
ALEKAGWSVGDLDLVEANEAFAAQACAVNKGMGWDPSIVNVNGGAIAIGHPIGASGARVF
NTLVYEMRRRGAKKGLATLCIGGGMGVAMCVEAL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctgccaattccatcgttgtcgccagtgccgcgcgcacggccgtcggctccttc
aacggtgctttcgcggccacgccggcgcatgaactcggtgctgtcgtcatcaaggagctt
ttgtcgcgagccggtgtcgaggcagccgaggtcgacgaggtcattctcggccaggtgctg
accgcggcccagggccagaacccggcccgccaggcctcgatcattgccggcctgcccaag
gagaccactgcctggggcctcaaccaggtttgcggctcgggcctgcgcgccatcgcgctc
ggcatgcagcagatcgccaccggcgacgccaaggtgatcgttgccggcggacaggaatcg
atgtcgctgtcgccgcacgccgagcacctgcgcgccggcgtcaagatgggcgactacaag
atgatcgacaccatgatcaaggacggcctgtgggacgccttcaacggctaccacatgggc
aacaccgccgaaaacgtcgcacgccagttccagatcacccgtgacgatcaggatcagttc
gcgctggcctcgcagaacaaggccgaggccgcgcagaaggccggcaaattcaaggacgaa
atcgtcgccttcaccatcaagggtaggaagggcgacaccattgtcgaccaggacgaatac
atccgccacggcgccacgctcgacgccatgaccaagctgaagccggccttcgacaaggac
ggctcggtgaccgccgccaacgcctccggcatcaatgacggagccgctggcgcgctgctg
atgagcgaagcggaggccgcaaggcgcggcatcaccccgctggtgcgcattgcatcctgg
gcaaccgccggtgtcgatccggcgatcatgggaaccggcccgatccccgcctcgcgcaag
gctttggagaaggccggctggtcggtcggcgatctcgacctggtcgaggccaacgaggcc
tttgccgcgcaggcctgcgccgtcaacaagggcatgggctgggatccctcgatcgtcaac
gtcaatggcggcgccatcgccatcggccatccgatcggtgcctcgggcgcccgcgtcttc
aacacgctggtctacgagatgcgccgccgcggcgccaagaagggcctcgccacgctgtgc
atcggcggcggcatgggcgtcgccatgtgcgttgaagcgctctga

DBGET integrated database retrieval system