KEGG   Mesorhizobium loti NZP2037: A9174_07050Help
Entry
A9174_07050       CDS       T04711                                 

Definition
(GenBank) RNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
mln  Mesorhizobium loti NZP2037
Brite
KEGG Orthology (KO) [BR:mln00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mln03009]
    A9174_07050
Enzymes [BR:mln01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     A9174_07050
Ribosome biogenesis [BR:mln03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A9174_07050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2
Motif
Other DBs
NCBI-ProteinID: ANN61293
Position
complement(1445980..1447035)
Genome map
AA seq 351 aa AA seqDB search
MSAHNEEAPELIEDRFIAAEPTVLVVGADAAGQRLDQWLAASLGPDMSRSRVQMLIRQGA
VSIDGKPADETKRKMIAGESVSVAMPEPEPAAPQGEAIALEVLYEDDALIVINKPAGLVV
HPGAGNWTGTLVNALIHHCGDSLSGIGGVRRPGIVHRLDKETSGVMVVAKTDRAHKALSE
AFADHGRTGDLERAYLALVWGIPQRPTGTVDAPLGRAADRVRRAVVPEGRDDARHAVTHF
AVQERFGEKQQEFATASLVECRLETGRTHQIRVHMAHIGHPVIGDPDYGQAFRTKTNRLP
EPLKNQVKAFSRQALHAWLLAFRHPDTHLLVRFEAPIPGDMEELVSGFRNL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcataacgaagaggcccccgaattgatagaggatcgattcatcgcggctgaa
ccgacggtgctggtggtgggcgcggatgcggccggccagcgcctcgaccaatggctggcg
gccagcctcggccctgatatgtcgcgcagccgcgtgcagatgctgatcaggcaaggcgct
gtgagcatcgacggcaagccggccgacgagaccaagcgcaagatgatcgcgggcgaaagc
gtgtcggtcgccatgccggaaccggagccggccgcgccgcagggcgaggccatcgcgctc
gaggtgctctatgaggacgacgcgctgatcgtcatcaacaagccggcggggctggtcgtg
caccccggcgccggcaactggaccggcacgctggtcaacgctctgatccatcactgcggc
gacagcctgtctggcattggcggggtgcgccggccgggcatcgtccaccgcctcgacaag
gagaccagcggcgtcatggtggtggccaagaccgaccgcgcccacaaggcgctgtcggag
gccttcgccgatcacggccggaccggcgatctcgaacgcgcctatctggcgctggtctgg
ggcataccgcagcggccgaccggaacggtcgacgcgccgcttggccgcgccgccgaccgg
gtgcgccgcgccgtggtgccggaaggccgcgacgatgcccgccatgccgtcacccacttt
gccgttcaggagcgtttcggcgaaaaacagcaggaattcgccaccgccagcctggtcgaa
tgccggctggaaaccggccggacccaccagatccgtgtccatatggcccatatcggccac
ccggtcatcggcgaccccgactacggccaggccttccgcaccaagaccaaccggctgccg
gagcccctgaaaaatcaggtcaaggcattttcacggcaagctttgcatgcctggctcctt
gcatttcgccatcccgatacccatctactggtgaggttcgaggcgccgatcccgggggac
atggaggaactcgtcagcggctttcgcaatctctaa

DBGET integrated database retrieval system