KEGG   Mesorhizobium loti NZP2037: A9174_09720Help
Entry
A9174_09720       CDS       T04711                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00260  Glycine, serine and threonine metabolism
mln01100  Metabolic pathways
mln01110  Biosynthesis of secondary metabolites
mln01120  Microbial metabolism in diverse environments
mln01130  Biosynthesis of antibiotics
mln01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mln00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A9174_09720
Enzymes [BR:mln01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     A9174_09720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ANN57019
Position
complement(1985791..1986843)
Genome map
AA seq 350 aa AA seqDB search
MFFASDNWAGAHPNIVAGLSAAAGGFATAYGDGALDQAVYIRFNEIFEREVAVFFVATGT
AANALSLTTFNKPGGISFAHRESHVIEDECGAPEYFSGGARLHAVDGALGKIDAHNLERT
IGRFAPEIVHWGRPMAVSITQSTEVGTIYGLNEIETISAIAKRHSVPLHMDGARFANALV
ALDTTPAEMTWKRGVDILSFGGTKNGCWCAEAIVLFDLDRAKELAFLRKRAAQLFSKSRF
VAAQFEAYFKDGLWLDTARHANAMAARLAAAIEDSAHAKLAWLPQANEVFAVIKKTEAER
LQAAGAAFYDWHKPHGFDGHIGEDELLYRFVTSFATSAEEVDRFGKLIAG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcgcttccgacaattgggcaggcgcccatcccaacatcgttgccggcctgtcg
gccgcggccggcggctttgccaccgcctatggcgacggcgcgctcgaccaggcggtctac
atcaggttcaatgagattttcgaacgcgaggtcgcggtgttcttcgtagcgaccggcacc
gccgccaacgcgctgtcgttgaccaccttcaacaaacccggcggcatttcctttgcccac
cgcgaatcgcatgtcatcgaagacgaatgcggcgcgccggagtatttttccggcggcgcg
cgcttgcacgccgtcgacggcgcactgggcaagatcgacgcgcacaatctggagcggacc
attggccgcttcgcgcccgaaatcgtccactggggacggccaatggcggtttcgatcacc
cagtcgaccgaggtcggcactatctacggcctgaatgagatcgagacgatttcggccatc
gcaaaacggcattccgtgccgctgcacatggatggcgcccgctttgccaatgcgctggtc
gcgctcgacacgacgccggccgaaatgacctggaagcgcggtgtcgacatcctgtccttc
ggcggcaccaagaatggctgctggtgcgccgaagcgatcgtgctgttcgacctcgaccgc
gccaaggaattggccttcctgcgcaagcgcgccgcccagctgttttcgaagtcgcggttc
gtcgccgctcagttcgaagcctatttcaaggacggtctgtggctcgacacagcgcgccac
gccaacgccatggccgcccgcctcgcggcggcgatcgaggattcggcccacgcgaagctg
gcctggctgccgcaggccaacgaggtgttcgccgtgatcaagaagaccgaggccgagagg
ctgcaggctgccggcgccgccttctacgactggcacaagccgcacggctttgacggccat
atcggcgaggacgagctgctctatcgtttcgtcaccagcttcgcgacgtcagccgaggaa
gtcgaccgctttggcaagttgatcgccggataa

DBGET integrated database retrieval system