KEGG   Mesorhizobium loti NZP2037: A9174_14015Help
Entry
A9174_14015       CDS       T04711                                 

Definition
(GenBank) hydrolase
  KO
K18614  2-(acetamidomethylene)succinate hydrolase [EC:3.5.1.29]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00750  Vitamin B6 metabolism
mln01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mln00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A9174_14015
Enzymes [BR:mln01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.29  2-(acetamidomethylene)succinate hydrolase
     A9174_14015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Thioesterase Esterase Ndr
Motif
Other DBs
NCBI-ProteinID: ANN57764
Structure
PDB: 

Position
2926830..2927666
Genome map
AA seq 278 aa AA seqDB search
MDMAADIASDHFISRRVDIGRVTLNVREKGSGPLMLFFHGITSNSAVFEPLMIRLSDRFT
TIAVDQRGHGLSDKPETGYEANDYADDIAGLIRTLDRGRAILVGHSLGARNSVTAATKYP
DLVRSVVAIDFTPYIETDALDALEERVNAGSQLFEDVKAVEAYLAGRYPNIPADAIRIRA
ESGYQPVDGGLRPLASPAAMAQTAKGLRSDLVPAYRDVTKPVLIVRGEASKLVSAAALAK
TSRLRPDLPVVVVPGADHYVNEVSPEITLKAITNFIDA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggacatggcggcagacatagcttccgaccacttcatctcgcgacgcgtcgacattggc
cgcgtcaccttgaacgtgcgcgagaagggcagcggtcccttgatgctgttcttccacggc
atcacctccaactccgccgtcttcgaaccgttgatgatccggctttcggaccggtttacg
acgattgcggttgatcagagggggcatggcctcagcgacaagccggaaaccggctacgag
gcgaatgactacgcggacgacatcgccggcctgatacgcacgctcgatcgcggccgtgcc
atcctcgtcggacattcgcttggtgctcgaaactccgtcacggccgcgacgaaatacccg
gatctggtgcggtcggtcgttgcgatcgactttacgccctacatcgagaccgacgccttg
gacgccttggaagagcgcgtgaacgcggggagccagcttttcgaggatgtgaaggccgtc
gaagcatacctagccggccgctatccgaacattcccgccgacgccatcaggatcagggct
gaaagcggctatcagccggtcgacggcggattgcgtccattggcatcgcccgcggccatg
gcgcagaccgccaagggcctgcgatcggatctggtgcccgcctaccgagacgtgacgaag
cccgtcctcatcgttcggggtgaggcgagcaagctggtttcggcggctgcgctggcgaag
acaagccgactgcggcccgatctgcctgtcgtcgtcgttccgggcgccgaccactacgtc
aacgaggtatctcccgagatcacgttgaaagccatcaccaacttcatagacgcgtga

DBGET integrated database retrieval system