KEGG   Mesorhizobium loti NZP2037: A9174_20790Help
Entry
A9174_20790       CDS       T04711                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mln00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A9174_20790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mln01007]
    A9174_20790
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mln03016]
    A9174_20790
   03029 Mitochondrial biogenesis [BR:mln03029]
    A9174_20790
Enzymes [BR:mln01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     A9174_20790
Amino acid related enzymes [BR:mln01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   A9174_20790
Transfer RNA biogenesis [BR:mln03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A9174_20790
 Prokaryotic Type
   Other AARSs
    A9174_20790
Mitochondrial biogenesis [BR:mln03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A9174_20790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1e tRNA-synt_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ANN58936
Position
4324064..4325821
Genome map
AA seq 585 aa AA seqDB search
MNIFADFTARVTKAVEALDLKDKDGVSPDLSRIAVEPPRDASHGDLATNAAMVLAKPTGQ
NPRALAERLALALRDDKDVAAAEVAGPGFVNLRLKDGFWQAHLSALLGEGRNYGRSTIGA
GRKTNVEYVSANPTGPMHVGHCRGAVVGDALANLMAFAGYDVTKEYVINDAGGQIDVLGR
SVSLRYREALGDDIGEIPPGLYPGDYLVPLGQALAREFGRGLLQMTEDEALAIVKDRAID
AMMAMIRDDLALLNVHHDVFFSERTLHADNARKIRSAINDLTLKGHIYKGKLPPPKGEKP
DDWEDREQTLFRSTAVGDDMDRALVKSDGSFTYFAADVAYLKDKVDRGFVDLIYVLGADH
GGYVKRLEALARAITGDKVKLTVLLCNLVKLFRDGEPVRMGKRAGNFVTAREVIEEVGRD
AVRFMMLFRKNDAPLDFDFAKVTEQSKDNPVFYVQYASARCHSVFRQASEQLGEANFDRK
SLAAAAASLTDEGEIGLIRKLAEYPRLIESAALALEPHRLAFYLYDLASSFHGHWNRGTD
NPDLRFVKVNDRQLTHARLGLVQAVSDVLTSGLTLIGAAAPTEMR
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcttcgccgatttcaccgcgcgagtcacaaaggctgtcgaagcgcttgatctg
aaagacaaggacggcgtttcgcccgacttgtcgcgcattgccgtcgaaccgccgcgcgac
gccagccatggcgatctcgcgaccaatgcggcgatggtgctggccaagcccaccggccag
aacccgcgcgctctggctgaaaggctggcgttggcgttgcgcgatgacaaggatgtcgcc
gccgccgaggttgccggccccggctttgtcaatctgcggctcaaggacggcttctggcag
gcgcatctgtcggcgcttctgggcgaggggcgcaattacggccgctcgacgatcggcgcc
ggccggaaaaccaatgtcgaatatgtctcggccaacccgactgggccgatgcatgtcggc
cattgccggggcgcggttgtcggcgatgcgctggccaatctgatggcgttcgccggttac
gacgtgaccaaggaatatgtcatcaacgatgccggcggacagatcgacgtgctcggccgg
tcggtcagcctgcggtaccgtgaggcgctcggcgacgacatcggcgagattccgcccggc
ctttatcccggcgattatctggttcctctcggccaggctctggcgagagagttcggccgc
ggcctactccagatgacggaggatgaggcgctcgccatcgtcaaggaccgcgcgatcgac
gcgatgatggcgatgatccgcgatgacctggcgctgctcaacgtgcatcacgacgtgttc
ttctccgaacgcacgctgcacgctgacaatgccaggaagatccgttcggcgatcaacgac
ctgacgctgaagggacatatctacaagggcaagctgccgccgcccaaaggcgagaagccg
gacgattgggaagatcgcgagcagacgctgttccgctcgacggcggtcggcgacgacatg
gaccgggcgctggtcaagtcggacgggtcgttcacctatttcgccgccgacgtggcgtat
ctgaaggacaaggtcgatcgcggcttcgtcgacctgatctacgtacttggcgccgaccat
ggcggctacgtcaagcggctggaggccttggcgcgggcgattaccggcgacaaggtgaag
ctcacggtcctgctttgcaatctggtcaagctgtttcgcgacggcgagccggtgcgaatg
ggaaaaagggctgggaatttcgtcacggcgcgggaagtcattgaagaggtgggccgtgac
gcggtgcggttcatgatgctgttccgcaagaatgacgcgccgctcgatttcgatttcgcc
aaggtcaccgaacagtccaaggacaatccggtgttttacgtgcagtacgcttcggcgcgc
tgccattcggtgttccggcaggcaagcgagcaactgggcgaggcgaatttcgatcgcaaa
agcctggctgccgcggcggcttcgctgaccgacgagggcgagatcggcctgatccgcaag
ctcgccgaatatccacgcctgatcgaatccgcggctcttgcgctggagccgcataggctg
gcattttacctttatgatctggcttccagtttccacggacactggaaccggggtacggat
aatccggacttacgttttgttaaggttaacgaccgacaattgacgcatgccagactaggg
ctggtgcaggctgtttcggacgttctgacgtccggcctgacgttgatcggagccgctgcg
cccaccgaaatgcgttag

DBGET integrated database retrieval system