KEGG   Mesorhizobium loti NZP2037: A9174_23860Help
Entry
A9174_23860       CDS       T04711                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00520  Amino sugar and nucleotide sugar metabolism
mln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A9174_23860
Enzymes [BR:mln01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     A9174_23860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 NodS Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ANN59458
Position
complement(4954974..4955945)
Genome map
AA seq 323 aa AA seqDB search
MPHSVLVSGGCGFLGSHLVDRLLLREDLETLVIVDNLWTGSRDNIAHVSDPRLSLRIADA
ESFTTSQHFDEIIHLASPASPVWYMREPARTIKANIGGALNLLSLLRPGGRFCFASTSEV
YGDPLMSPQPESYRGSVDCTGPRASYDESKRCTEALLFEEQRVSGLDVRVVRLFNTYGPR
TRIDDGRAVSNFVCQALTTGILTVHGDGSQSRSWGYVDDIVDGLERFFWRDSIAYRGPLN
IGNNREVSVLGIAKFVCSLVPGSRIEHRAPIPQDPTNRCPDLTLVRQVLPGWEATTGYQE
GIRRTFEWYRRRIVTEDRSAASA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgccgcacagcgtgttggtttctggtggctgcggctttctcggctcccatcttgtcgat
cgtctgctgctgcgtgaggatctggaaacgctggtcatcgtcgacaatctgtggaccgga
tcgcgcgacaacattgcccatgtctcggacccgcggctcagcttgcggattgccgatgcc
gaaagcttcacgaccagccagcatttcgatgagatcatccatctggcgtcaccggcttcg
cccgtatggtacatgcgcgagccggcgcgcacgatcaaagccaatataggcggcgcgctc
aatcttctgtcgctgctcaggcccggcggtcgcttctgcttcgcctcgacctcggaagtc
tatggcgatcccctgatgtcgccgcaaccggagagctaccggggatccgtggactgcacc
gggccacgggcctcctatgacgagagcaagcgctgcaccgaggcgctgcttttcgaagag
caacgcgtcagcgggctcgatgtgcgcgtcgtcaggctgttcaacacctatgggccgcga
acgcgcatcgatgacggccgcgccgtttcgaattttgtctgccaagccctgaccacggga
atcctgaccgtccatggcgacggctcccaatcgcgcagttgggggtatgtggacgatatc
gtcgatggcctggaacgtttcttttggcgcgacagcatcgcataccgaggacccctgaac
atcggcaacaatcgcgaggtctcggttctcggtatcgcgaaattcgtctgctcgcttgtt
ccaggcagccgcatcgaacaccgtgcgccaattccgcaggatccgacaaaccgctgcccg
gacttgaccctggtaaggcaggttcttcccggatgggaggcgacgaccggctatcaggaa
gggatccggcgcaccttcgagtggtaccggcgacggattgtgactgaggacagatcggcg
gcaagcgcctga

DBGET integrated database retrieval system