KEGG   Mesorhizobium loti NZP2037: A9174_30060Help
Entry
A9174_30060       CDS       T04711                                 

Definition
(GenBank) dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A9174_30060
Enzymes [BR:mln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A9174_30060
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A9174_30060
    1.1.1.-  
     A9174_30060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Sacchrp_dh_NADP Shikimate_DH ApbA TrkA_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ANN60533
Position
complement(6216424..6217449)
Genome map
AA seq 341 aa AA seqDB search
MKAARLYGPGDLRVEHIAPPGIPDAGWVKLRVDAAGICGSDLHNFRTGQWISRSPSTAGH
ELTGTVTAIGEGVGTVAVGDRVVADSRFWCGECAQCHAGRRHLCASLGFVGEVCDGGFAE
QAVLPARLLHVVDAELDERVAAMAEPLAVALHAVRRLPKTAGPVLVVGCGPIGGLAALLL
SQSFAGAVLVADRNQARCDRVARVTGAKIVDLDRDAIAAATGNAPLLAAVEATGSIAAFT
QLLGVLDSGSTVAMVGIFHGRLDIDPNLLVEREIALLGCHAFADELPDAVRMLGELSEPL
LALIDREIGLDDIPATYERLLAGQSDGLKTIIRMRQPVEPA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcacggctttatggacccggcgatctgcgcgtggagcacattgccccgcca
ggcattccggatgccggctgggtgaagctcagggtcgatgccgccggcatctgcggttcg
gacctgcacaatttccgcaccggccaatggataagccgctcgccttcgacggccggccat
gagctgaccggcacggtgaccgcgatcggcgagggcgtcggcaccgtcgccgtcggcgac
agggtggttgccgattcccgcttctggtgcggggagtgcgcgcaatgccatgccggcagg
cgccatctctgcgcttcgctgggctttgtcggcgaggtctgcgacggcggtttcgccgaa
caggctgttttgcccgcacgcttgctgcatgtcgttgatgcggaacttgacgagcgggtc
gccgcgatggccgagccgctcgcggtggcgctgcacgcggtgcggcgtctgcccaagacg
gcaggcccggtgctcgtcgtcggctgcgggccgatcggcggtctcgccgcgctgctgctt
tcgcagagctttgcaggcgccgtgcttgtcgccgaccgcaaccaggcgcgctgcgaccgc
gtggcgcgggtgaccggcgcaaaaatcgttgacctcgaccgcgatgccattgccgcagcg
actggcaacgcccccttgctggcggccgtcgaggcgaccggcagcatcgccgcgttcacc
cagttgctcggcgttctcgattccggcagcacggtggcgatggtcggcatcttccatggc
cgtctcgacatcgatcccaaccttctggtcgaacgcgagatcgcgctgctggggtgccat
gccttcgccgacgaactgcccgacgccgtgcggatgctgggtgaattgagcgaacctttg
ctcgccctgatcgatcgcgagatcggtctcgacgatattccggccacttatgagcggctg
ttggcggggcaaagcgacggcttgaaaacaatcatccgcatgcggcaacctgttgagccg
gcgtga

DBGET integrated database retrieval system