KEGG   Mesorhizobium japonicum MAFF 303099: mll4964
Entry
mll4964           CDS       T00043                                 
Name
(GenBank) transcriptional regulator, LacI (ribose operon repressor) family
  KO
K02529  LacI family transcriptional regulator
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mlo03000]
    mll4964
Transcription factors [BR:mlo03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    mll4964
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 Peripla_BP_4 LacI HTH_3
Other DBs
NCBI-ProteinID: BAB51500
RhizoBase: mll4964
UniProt: Q98CX1
Position
complement(3936345..3937370)
AA seq 341 aa
MTDIARAAGCSQATVSFVLNNSPGIKLSQQTRERVIEAARALGYSAPAFSALRKPVAAFD
GLDGVIGFAVDQLATSPEAVVAIEGARQASWNAGNVLLVAQTMGDAVMEPRAIQALTRRG
ISALIYMTIFTREITAPDYLYSLDIPVILLNCYTADYAFPAVVPSEIAGGQSSTRHLISH
GHRRIATITGEPWMQAAQDRLKGYRRALATADIPFDPDLVVEGDWSASAGYAATVKLLAL
KDRPTAIFCQNDRTAIGCYEALKEAGLHIPQDISVVGYDDEEIARHLFPPLTTSILPHMA
MGQWAIEQLEAPTAPGQGRYPITKLECPLVERESVRGVVGG
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccgatatcgcccgggccgccggctgctcacaggcgacggtttccttcgtgctcaac
aattcgccagggatcaagctgtcgcagcagacccgggagcgggtgatcgaggccgcacgg
gcgctgggctacagcgcgcccgccttctcggcgctgcgcaagccggttgccgccttcgac
gggctggacggggtgatcggctttgccgtcgaccagctggcgaccagcccggaagcggtg
gtggcgatcgaaggcgcgcgccaggcctcgtggaatgccggcaacgttctcctggtggcg
cagaccatgggcgacgccgtgatggagccacgcgccatccaggcgctgacaagacggggc
atttcggcgctgatctacatgaccatcttcacccgcgaaatcaccgcgcccgactatctc
tacagcctcgacatcccggtgatcctgctcaattgctacacggccgactatgccttcccc
gccgtggtgccgtccgagatcgccggcggccagagctcgacaaggcacctgatcagccac
ggccaccgccgcatcgccaccatcaccggcgagccgtggatgcaggccgcacaggaccgg
ctgaaaggctatcgccgcgcgctcgccaccgccgatatccccttcgacccggacctggtg
gtcgagggcgactggtcggccagtgccggctatgccgcgacggtgaagctgcttgcgctc
aaagaccgcccgaccgccatcttctgccagaacgaccgcaccgcgatcggctgctacgag
gcgctgaaggaagccggcctgcacattccgcaagacatttccgtggtcggctacgacgac
gaggaaatcgcccgacatttgttcccgccgctgaccacctccatcctgccgcacatggcg
atgggccaatgggcgatcgaacagctcgaagcgccgacggcgcccggacaggggcgctat
cccatcaccaagctggagtgcccgctggtggagcgggagagtgtgaggggggtggtggga
ggctga

DBGET integrated database retrieval system