KEGG   Mesorhizobium japonicum MAFF 303099: mll0037Help
Entry
mll0037           CDS       T00043                                 

Definition
(GenBank) probable outer membrane protein B; OmpB
Organism
mlo  Mesorhizobium japonicum MAFF 303099
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4957
Motif
Other DBs
NCBI-ProteinID: BAB47710
RhizoBase: mll0037
UniProt: Q98NQ1
Position
complement(30662..31606)
Genome map
AA seq 314 aa AA seqDB search
MLLLASVFLIAPASAQATRTWVSGVGNDADPCSRTAPCKTFAGAISKTATAGEINCLDPG
GFGTVTITKSITIDCKTTEGGVLSALVNGIVVNTPVGSVVHLRGLDIDGAGTGLDGVRMT
GQGQLHIEDCNIERVTSNGVEFLPNGASELYISNTRIAEAVGGAILIKTTGAVGINAILS
RVELTNSANGILVDGTGNTSAMNMALTDSLVSGNTGNGVAVKSVAAASSVRATIVNTTIS
SNAGIGVNANGAAASGAGSAIAFLGASTVFGNVTGVSNTGSGAVQSFKNNMISGNVADGT
PITAFPGPGGTPLQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgttacttctggcatcagtcttcctgattgctccggcttccgcgcaagcgacacggacc
tgggtttccggcgtcggcaacgacgccgatccgtgcagccgaacggcaccttgtaagacg
tttgccggcgccatctcgaagacggcgacggccggcgagatcaactgtctggacccgggc
ggatttggcacagtcaccatcaccaaatccatcaccatcgactgcaaaaccaccgaaggc
ggtgtgctttcggcgctcgtgaacggcatcgtcgtcaatacgcctgtcggctccgtcgtg
catcttcgcggcctcgacatagacggcgcgggcaccggactcgacggcgtgcggatgacc
ggccaaggtcaactgcatatcgaggactgcaacatcgagcgggtgaccagcaatggcgtc
gaatttcttcccaacggggccagcgaactctacatcagcaatacgcggatagccgaggca
gtcggtggcgccattcttatcaaaacgactggcgccgttggcatcaatgccatcctgtcc
agggtggaactgaccaacagcgccaatggcattcttgtcgacggcaccggcaacacctcc
gccatgaatatggcactgaccgacagcctggtcagcggcaacactggcaacggggtggcg
gtcaagtccgtcgccgcggcatcgtcggtacgcgcgacgatcgtcaacaccacgatcagt
tccaatgccggcatcggagtcaatgccaacggcgccgccgccagcggcgccggcagcgcc
atcgcctttctcggcgcctcgaccgtgttcggcaatgtcaccggggtcagcaacaccggc
agcggcgccgtccagtcgttcaagaacaacatgatctccggcaacgtggctgacggcact
ccgatcacggccttcccgggccctggcggcacgccgctgcaataa

DBGET integrated database retrieval system