KEGG   Mesorhizobium japonicum MAFF 303099: mll0202Help
Entry
mll0202           CDS       T00043                                 

Definition
(GenBank) leucyl/phenylalanyl-tRNA-protein transferase
  KO
K00684  leucyl/phenylalanyl-tRNA---protein transferase [EC:2.3.2.6]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    mll0202
Enzymes [BR:mlo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.6  lysine/arginine leucyltransferase
     mll0202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Leu_Phe_trans Acetyltransf_6
Motif
Other DBs
NCBI-ProteinID: BAB47837
RhizoBase: mll0202
UniProt: Q98NC4
Position
complement(137018..137635)
Genome map
AA seq 205 aa AA seqDB search
MTRPYAPGYRIPTDLLLKAYASGVFPMAESASDPEVFWVRPETRGIIPLDGFHTPKSLRK
TIRKSLFDIRFDFDFEATIDGCAEKREERRSTWINAPIREAYVQLHRMGHCHSVEAWRED
QLVGGLYGVSLGRVFFGESMFSKETDASKICLVHLVERLKARGFALLDTQFTTEHLKRFG
AVDVPRGKYEKMLAEALKGEAIFFP
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcccttacgcgcctggctatcgcatccctaccgaccttctgctcaaggcctac
gcttcgggcgtcttcccgatggccgaaagcgccagcgacccagaagtgttctgggtgcgg
ccggagacgcgcggcatcatcccgctcgacgggttccacacgcccaaaagcctgcggaag
acgatccgcaaaagcctgttcgacatccgtttcgacttcgatttcgaggcgacgatcgac
ggctgtgccgaaaagcgcgaggagcggcgctcgacctggatcaacgcgccgatccgcgag
gcctatgtccagttgcaccgaatgggccattgccattcggtcgaggcctggcgcgaggac
cagttggtcggcggcctctatggcgtgtcgcttggacgggttttcttcggcgaaagcatg
ttttccaaggagacggatgcgtcgaaaatctgcctcgtgcatcttgtcgagcgcttgaag
gcacgtggcttcgctctgcttgatacgcaattcaccacagagcacctcaagcgcttcggc
gctgtcgacgtcccgcgcggcaagtatgagaagatgttggccgaagcactgaagggcgag
gctatcttttttccgtag

DBGET integrated database retrieval system