KEGG   Mesorhizobium japonicum MAFF 303099: mll0209Help
Entry
mll0209           CDS       T00043                                 

Definition
(GenBank) hypothetical protein
Organism
mlo  Mesorhizobium japonicum MAFF 303099
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M48 TPR_2 TPR_16 TPR_21 TPR_1 TPR_14 TPR_15 Reprolysin_2 TPR_8 TPR_11 Peptidase_M4
Motif
Other DBs
NCBI-ProteinID: BAB47842
RhizoBase: mll0209
UniProt: Q98NB9
Position
complement(140932..142386)
Genome map
AA seq 484 aa AA seqDB search
MRKFSGADFSSFARSSTSEHVMLSRPRSTIARIARVFTTLSLGLAVAVASSVTAFAQSVP
VVRDAEIEALVRDYARPIFKAAGLANDGIDIVLVNDSSFNAFVTGRRLFINTGALMTAET
PNEIIGVIAHEAGHIAGGHQQKLRDQLERAKTMAIIATLLGAGAIVAGATTNSRGLAGAG
MGVAAGGGEMAQRSILAYQRTEEITADRSAITYLNATGQSGMGMLKTFRRFQTALSLSGA
QVDPYRISHPMPQERIANLEVLVKQSPNVDKLDPPTLQQRHDMMRVKIAVYMEGQAAAAR
LLQKMRGSLAAQYGDAQSTYLYGDIAGALAKTNALIKAQPKNAYFQELRGDILMKANKPK
DAAEAYAKAVSLDPARSGLLPVSLGQALMAVGTPDSLKKAVVQINNGLGRDKENSEGYRY
LAQAYGELGDIPGAELATAEGHFYSGNYKDAKIFAMRAQQQMKRGEPRWIRAQDIINYKS
SNKI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaagttttccggtgccgacttttcatctttcgcccgctcgtctaccagtgaacac
gtcatgttgagccgacccagatcgacgattgccaggatcgcgcgtgttttcacgacgctt
tcgctcggccttgccgttgccgtggcaagttcggtcaccgccttcgcccagagcgttccg
gtggtgcgcgatgccgagatcgaggctttggtgcgcgactatgcacggccgatcttcaag
gcagccgggctggcgaatgacggcatcgacatcgtgctggtcaatgattccagcttcaac
gcttttgtcaccgggcgacggctgttcatcaacaccggcgcgctgatgacggcggaaacg
cccaacgagatcatcggcgtcatcgcgcacgaggccggccatatcgccggcggccaccag
cagaaactgcgtgaccagctcgagcgcgccaagacgatggccatcattgcgaccttgctt
ggcgcgggcgcgatcgtcgctggcgcgaccaccaacagccgcggccttgccggcgccggc
atgggcgtggccgccggcggcggcgagatggcacagcgcagcatcctcgcctatcagcgc
accgaggagataacggccgaccgctccgccatcacctatctcaacgccaccggccagtcc
ggcatgggcatgctgaagacgttccggaggttccagaccgcgctgtcgctgtcgggtgcg
caagtcgatccctatcggatcagccatccgatgccgcaggagcgcatcgccaatctcgaa
gtgctggtgaagcagagccccaatgtcgacaagctcgacccgccgacgctgcagcagcgc
catgacatgatgcgggtgaagatcgccgtctacatggaaggccaggccgccgcggcgcgg
ctgctgcaaaagatgagaggcagcctcgccgcgcagtatggcgacgcccaatcgacctac
ctttacggcgacatcgccggcgcactcgccaagaccaatgccctgatcaaggcgcagccg
aagaatgcctatttccaggagttgcgcggcgacatcttgatgaaggcgaacaagcccaag
gacgcggcggaagcctacgccaaggcggtcagcctcgatccggcgcggtccggcttgctg
cctgtctcgctcggccaggcgctgatggcggtcggcacgccagactcgctgaagaaagcc
gtcgtgcagatcaacaatggcctgggccgcgacaaggaaaattccgaaggctatcgctac
ctggcccaggcttacggcgagctgggtgacataccgggcgccgagctggccacggcggaa
ggtcatttctattccggtaactacaaggatgcgaagatcttcgccatgcgggcgcagcag
cagatgaagcgcggcgagccgcgctggatacgcgcccaggacatcataaactacaaatcg
tcaaacaagatctag

DBGET integrated database retrieval system