KEGG   Mesorhizobium japonicum MAFF 303099: mll0610Help
Entry
mll0610           CDS       T00043                                 

Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00010  Glycolysis / Gluconeogenesis
mlo00051  Fructose and mannose metabolism
mlo00562  Inositol phosphate metabolism
mlo00710  Carbon fixation in photosynthetic organisms
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01120  Microbial metabolism in diverse environments
mlo01130  Biosynthesis of antibiotics
mlo01200  Carbon metabolism
mlo01230  Biosynthesis of amino acids
Module
mlo_M00002  Glycolysis, core module involving three-carbon compounds
mlo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mll0610
   00051 Fructose and mannose metabolism
    mll0610
   00562 Inositol phosphate metabolism
    mll0610
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    mll0610
Enzymes [BR:mlo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     mll0610
Exosome [BR:mlo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   mll0610
  Exosomal proteins of bladder cancer cells
   mll0610
  Exosomal proteins of melanoma cells
   mll0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Pas_Saposin
Motif
Other DBs
NCBI-ProteinID: BAB48166
RhizoBase: mll0610
UniProt: Q98ME7
Position
complement(476665..477435)
Genome map
AA seq 256 aa AA seqDB search
MTPGIRPLVAGNWKMNGTSASLNELRMIGNGFMSGLDAETEALVCVPATLLSHAAEILSR
TPVHAGGEDCHTKESGAYTGCISAEMLKDAGASHVIVGHSECREQRGEDDATVQAKAAAA
WRAGLVAIICIGETQQQREAGATLEVLSRQVAGSVPPSATPSNTVIAYEPVWAIGTGLTP
TAADVAEAHAHIRERLSEKLGASAAKTRILYGGSVKPSNAVELLGVRNVDGALVGGASLK
AADFLGIAEAYRSISG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgccaggaattcgcccgcttgtcgccggcaactggaaaatgaacggcaccagcgct
tcgctgaacgagctcaggatgatcggcaacgggttcatgagcgggctcgacgcggagacc
gaggcgctggtctgcgttcccgcgacgctgctttcccatgcagccgagattctgtcgcgc
acgccggtccatgcgggcggcgaggattgccacaccaaggaaagcggcgcctacaccggc
tgtatctcggcggaaatgctgaaggacgccggcgcgagccatgttattgtcggccattcc
gaatgccgcgaacaacgcggcgaggacgatgcgacggtccaggccaaggccgccgccgca
tggcgcgccgggctcgtggccatcatttgcatcggcgagacgcagcagcagcgtgaggcg
ggcgccacgctcgaggtgctgtcgcgccaggtcgcaggttcggtgccgccgagtgccacg
ccatccaacaccgtcattgcctatgagccggtgtgggcgatcggcaccggcctgacgccg
accgcggccgatgtggccgaagcgcatgcgcatatccgcgaaaggctgtcggagaaactt
ggtgcctctgccgccaagacgcgcattctctacggtggctcggtcaagccgtccaacgcg
gtggaactgctgggcgtcaggaatgtcgatggcgcgctggttggcggcgccagcctgaaa
gcggccgatttcctcggtatcgccgaggcctatcgcagcatttcaggctga

DBGET integrated database retrieval system