KEGG   Mesorhizobium japonicum MAFF 303099: mll0675Help
Entry
mll0675           CDS       T00043                                 

Definition
(GenBank) Glu-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00970  Aminoacyl-tRNA biosynthesis
mlo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    mll0675
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mlo03029]
    mll0675
Enzymes [BR:mlo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     mll0675
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     mll0675
Mitochondrial biogenesis [BR:mlo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    mll0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAB48218
RhizoBase: mll0675
UniProt: Q98M95
Position
complement(529288..530853)
Genome map
AA seq 521 aa AA seqDB search
MSDLTRLTISQARAKLRGKEITATEITEAYLSAIDRANPALNAYVAVTGDRARDMAKASD
ARLVKGEGGALEGIPLGIKDLFGTEGVHTQACSHVLDGFKPLYESTVTANLWADGAVMLG
KLNMDEFAMGSSNETSYYGPVINPWRRSRLDTVVMPTTHQGDGGFVSAGGTKTQRSLDNA
QLVPGGSSGGSATAVSAFLCAGATATDTGGSIRQPAAFTGTVGIKPTYGRCSRWGIVAFA
SSLDQAGPIARDVRDAAILLKSMASVDPKDTTSVDRPVPDYEAAIGKPIKGMKVGIPKEY
RVDGMPEEIEALWQKGIAWLRDAGAEIVDISLPHTKYALPAYYIVAPAEASSNLARYDGV
RYGLRVPGKDIVEMYEKTRAAGFGREVKRRIMIGTYVLSAGYYDAYYLQAQKVRNLIKRD
FENVFAAGVDVILTPATPSAAFGIADEDMAADPVKMYLNDIFTVTVNMAGLPGIAVPAGL
DPKGLPLGLQLIGRPFEEETLFQTAAVIEQAAGTFQPEKWW
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctgaccagactgacgatttcacaggctcgcgccaagctgcgcggcaaggaa
atcaccgcgacagagatcaccgaggcctatctctcggcgatcgatcgcgccaatccggcg
ctcaatgcctatgtcgcggtgactggcgacagagcgcgtgacatggccaaggcgtccgac
gccaggctggtcaagggcgagggcggggcgctggagggcattccgctgggcatcaaggac
ctgttcggcaccgaaggtgtccacacccaggcctgcagccacgtgctcgacggcttcaag
ccgctctacgaatcgactgtcaccgccaatctgtgggcggatggcgcggtcatgctcggc
aagctcaacatggacgagttcgccatgggctcgtccaacgagacctcctattacggcccg
gtcatcaacccgtggcggcgttcgcgcctcgacacggtggtgatgccgacgacgcatcag
ggcgacggcggttttgtctcggccggcggcacgaaaacccagcgcagcctggacaacgcg
cagctggttccgggtggctcttccggcggctcggcgacggccgtctcggcgttcctgtgc
gccggcgccacggcgaccgatacgggcggctcgatccgccagccggcggccttcaccggc
accgtcggcatcaagccgacctatggccgctgctcgcgctggggcatcgtcgccttcgcc
tcgtcgctcgaccaggccggaccgatcgcgcgcgatgttcgcgacgccgcgatcctgctc
aaatccatggcctcggtcgatccgaaggacaccacttccgtcgaccggccggtgccggac
tatgaggcggcgatcggcaagccgatcaagggcatgaaggtcggcattcccaaggaatac
cgcgttgacggcatgcccgaggagatcgaggcgctgtggcagaagggcattgcctggctc
agggatgccggcgccgagatcgtcgacatttcgctgccgcatacgaaatacgcgctgccg
gcctattacatcgtggcgcccgccgaggcttcgtccaacctggcgcgctatgacggcgtc
cgctacggcttgcgcgtgccgggcaaggacattgtcgagatgtatgagaagacccgcgcc
gccggtttcggccgcgaggtcaagcgccgcatcatgatcggcacctatgtgctgtcggcc
ggctattacgacgcctattatctgcaggcacagaaggtgcgcaatttgatcaagcgcgac
ttcgaaaatgtcttcgccgccggcgtcgacgtcatcctgaccccggcgacgccgtccgcc
gccttcggcatcgccgatgaggacatggccgccgacccggtgaaaatgtacctcaacgac
attttcacggtcaccgtgaacatggcgggcctgcccggcatcgccgtgcccgccggcctc
gatcccaaggggctgccgctcggcctgcagctgatcggccggccgttcgaggaagagacg
ctgttccagaccgccgccgtcatcgagcaggcggccggcacatttcagcctgagaagtgg
tggtaa

DBGET integrated database retrieval system