KEGG   Mesorhizobium japonicum MAFF 303099: mll1198Help
Entry
mll1198           CDS       T00043                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00860  Porphyrin and chlorophyll metabolism
mlo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    mll1198
Enzymes [BR:mlo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     mll1198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA MobB
Motif
Other DBs
NCBI-ProteinID: BAB48630
RhizoBase: mll1198
UniProt: Q98L33
Position
complement(1006926..1008401)
Genome map
AA seq 491 aa AA seqDB search
MARAIMLQGTGSDVGKTVLVAGLCRAAKKRGLKVRPFKPQNMSNNAAVADIPGDNNHGGG
EIGRAQWLQAIACGVAPSVHMNPVLLKPQSDVGAQVIVQGKVFGEARARDYQALKGRLMD
AVLDSWAKVGEGADLVIVEGAGSPAEINLRSRDIANMGFATRADVPVVLVGDIDRGGVIA
SVAGTHLILPEEDRRMIVGYLINKFRGDVSLFDDGLKAIEKFTGWRCFGVVPWLKAAARL
PSEDSVVLERLASGEARALKVAVPVLGRIANFDDLDPLKAEPQVEVVFVPPGKPLPSDAG
LVVIPGSKSTIGDLIRFRENGWDRDLATHRKRGGHVVGICGGFQMLGRRVRDPDGIEGSV
TEAEGLGLLDIETMMEPEKTVRNVSARSVQFDLPLEGYEIHLGRTTGPDTMRPSAIINGV
ADGAISADGKVIGTYMHGLFGADAFRGKFLESLGIKGGGIDYRVEVERALDDVAAELEGH
LDCDALFGLAR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggccagggcgatcatgctgcaaggcacgggttcggatgtcggcaagacggtgctggtc
gccggcctgtgccgcgccgcgaagaagcgcgggctcaaggtgcggccgttcaagccgcag
aacatgtcgaacaacgccgcggtcgccgacattccgggcgacaacaaccatggcggcggc
gagatcggccgcgcgcagtggctgcaggcgatcgcttgcggcgttgcgccgtcggttcac
atgaacccggtgctgctcaagccgcagagcgatgtcggcgcgcaggtcatcgtgcaaggc
aaggtgttcggcgaggcgcgcgcgcgcgattaccaggcgctgaagggtcggttgatggac
gccgtgctcgactcctgggcgaaagtcggcgagggcgccgatctggtcatcgtcgagggc
gccggctcgccggccgagatcaatttgcgcagccgagacattgccaatatgggctttgcc
acgcgtgcagatgtgccggtggtgctggttggcgacatcgaccggggcggtgtcatcgcc
tcggtcgcgggcacgcatctgatcctgccggaagaggaccggcgcatgatcgtcggctac
ctcatcaacaagttccgcggcgatgtttcgcttttcgatgacggcctcaaggcgatcgag
aaattcaccggctggcgctgctttggcgtcgtgccgtggctgaaggcggcggcgcggctg
ccttcggaggattcggtggtgctggagcgactggcatccggcgaggcgcgggcgctgaag
gtggcggtgccggtgctcggccgcatcgccaatttcgacgatctagatccgctcaaggcc
gaaccgcaggtcgaggtggtgttcgtgccgccgggaaagccgctgccatcagatgccggg
ctggtggtcattcccggctccaaatcgacgatcggcgatctcataagattccgcgagaat
ggctgggacagggatcttgccacacatcgcaagcgcggcggccatgtcgtcggcatttgc
ggtgggtttcagatgcttggccgcagggtgcgcgatcccgacgggatcgaaggcagcgtc
accgaggccgaagggcttggcctgctcgatatcgaaacgatgatggagccggagaagacg
gtgcgcaatgtcagcgcccgctcggtgcaattcgacctgcccctcgaaggctacgaaatc
catctcggccgcaccaccggcccggacacgatgcggccgtcggcgatcatcaatggcgtt
gcggacggtgcgatctccgccgatggcaaggtgatcggcacctatatgcacggcctgttc
ggcgccgacgcctttcgcggaaaattcctcgaaagccttggcatcaagggcggcggcatc
gactatcgcgtcgaagtcgagcgggcgctggacgacgtcgcggccgagttggagggccac
ctcgactgtgacgcgcttttcggcctggcgcgctaa

DBGET integrated database retrieval system