KEGG   Mesorhizobium japonicum MAFF 303099: mll1457Help
Entry
mll1457           CDS       T00043                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00670  One carbon pool by folate
mlo00790  Folate biosynthesis
mlo01100  Metabolic pathways
Module
mlo_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    mll1457
   00670 One carbon pool by folate
    mll1457
Enzymes [BR:mlo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     mll1457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: BAB48827
RhizoBase: mll1457
UniProt: Q98KI7
Position
complement(1214550..1215068)
Genome map
AA seq 172 aa AA seqDB search
MHVAIYVAIAENGVIGRDGGLPWRLSTDLKRFKADTMGKPIIMGRKTYEGIGRPLPGRLN
FVVTRDKTWRAEGVEVAHTLEAAIQLATVRVRCMSGVDEACIIGGGEIYAQALPLADRLH
VTHVLAAVDGDAHFPPIDAETWRMVSSQEVPAGEKDSHATRYSVYERRRQIL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtggcaatctacgtcgccatcgccgagaacggcgtgatcgggcgggacggcgga
ctgccctggcggctttcgaccgatctcaagcgcttcaaggccgacacgatgggcaaaccc
atcatcatgggccgcaagacttatgaaggcatcggccggccgctgccgggcaggctcaac
ttcgtcgtcacccgtgacaagacctggcgcgccgagggcgtcgaggtggcgcatacgctg
gaggccgcgattcagctggcaacggtgcgcgtccgctgcatgagcggcgtggacgaggcc
tgcatcatcggcggcggtgagatctatgcccaggcgctgccgctggccgaccggctgcac
gtcacccatgtgctggccgccgtcgacggcgacgcgcatttcccgccgatcgacgctgag
acatggcgcatggtcagttcgcaggaggttccggccggggaaaaggacagccacgcaacg
cgctattcggtttacgagcgccgccgccagatactttga

DBGET integrated database retrieval system