KEGG   Mesorhizobium japonicum MAFF 303099: mll3558Help
Entry
mll3558           CDS       T00043                                 

Definition
(GenBank) unknown protein
Organism
mlo  Mesorhizobium japonicum MAFF 303099
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AHSA1 Polyketide_cyc2 DUF2505
Motif
Other DBs
NCBI-ProteinID: BAB50424
RhizoBase: mll3558
UniProt: Q98FZ2
Position
complement(2868044..2868529)
Genome map
AA seq 161 aa AA seqDB search
MNQIAPVKDEHSVIHSTFTIERTYPQSPDRVFHAFADKATVRRWRVDGDGFTVAEFSFDF
RVGGGEVSRFSYGGGPEVRLDAQFQDIVPDQRIVFSYRMAIGPQPMSASLTTVELTPSGD
GTRLTYTEQGAFFDGVDSAKGREEGTRGLLEALAAELQKWK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagatcgcccccgtgaaggacgagcattccgtcatccactccacattcaccatc
gagcgcacgtacccgcaatcgccagatcgcgtcttccatgctttcgcggacaaggcgacg
gtgcggcgttggcgggtcgacggcgacggttttaccgtcgccgaattcagcttcgatttc
cgcgtcggtggtggcgaggtgtcgcgcttcagctatggcggcggcccggaggtcaggctc
gacgcccagttccaggacatcgttcccgatcagcgcatcgtgttttcctatcggatggca
atcgggccgcagccgatgtcggcatcgctgaccacggtggaactgacaccctcgggcgat
ggcacaaggctaacctataccgaacagggcgccttcttcgatggtgtggattccgccaag
gggcgggaggaggggacccgcgggctgctggaggccctggccgcggaactccagaagtgg
aagtaa

DBGET integrated database retrieval system