KEGG   Mesorhizobium japonicum MAFF 303099: mll4306Help
Entry
mll4306           CDS       T00043                                 

Definition
(GenBank) succinyl-coA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00020  Citrate cycle (TCA cycle)
mlo00640  Propanoate metabolism
mlo00660  C5-Branched dibasic acid metabolism
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01120  Microbial metabolism in diverse environments
mlo01130  Biosynthesis of antibiotics
mlo01200  Carbon metabolism
Module
mlo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mlo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    mll4306
   00640 Propanoate metabolism
    mll4306
   00660 C5-Branched dibasic acid metabolism
    mll4306
Enzymes [BR:mlo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     mll4306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 FimP
Motif
Other DBs
NCBI-ProteinID: BAB50995
RhizoBase: mll4306
UniProt: Q98EC5
Position
complement(3429123..3430316)
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQGKALLKSFGAPVAEGVPVFKASEAEAAARALPGPLYVVKSQIHAGGRGKGKFK
ELSPDAKGGVRLAKSVADVVANANEMLGHTLVTKQTGPAGKQVNRLYIEDGADIERELYL
SILVDRSVGRIAFVVSTEGGMDIEAVAHDTPEKVITVAIDPERGVTADDVKKLNAALKLD
GDAAKDGGTLFPILYKAFIEKDMSLLEVNPLIVMKNGRLRVLDAKVSFDNNALFRHPDVL
ELRDTTEEDEKEIEASKYDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITKDPAVKGILINIFGGIMKCDIIAEGVIAAVKEVGLEVPLVVRLE
GTNAELGKKIINDSGLNVVSADDLDDAAKKIVAAVKG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccatgaatatcaaggcaaggcgctgctgaagagctttggcgcgccggtggcc
gaaggcgtgccggtgttcaaggcgagcgaggcggaagccgcggcacgcgcgctgcccggc
ccgctctatgtggtgaagagccagatccatgccggcggccgcggcaagggcaagttcaag
gaactgtcgcccgacgccaagggcggcgtgcggctggcgaagtcggtcgccgacgtcgtc
gccaacgccaacgagatgctcggccacacgctggtgaccaagcagaccggcccggccggc
aagcaggtcaaccgcctctatatcgaggacggcgccgatatcgagcgggaactttatctg
tcgatcctggtcgaccgttccgtcggccgcatcgccttcgtcgtttcgaccgaaggcggc
atggacatcgaggcggtcgcccacgacacgccggaaaaggtcatcaccgtcgccatcgac
ccggaaaggggcgtgacggcggatgatgtgaagaagctcaacgcagccctcaagctcgac
ggcgacgccgccaaggatggcggcacgctgttcccgatcctctacaaggccttcatcgag
aaggacatgagcctgctcgaggtcaatccgctgatcgtcatgaagaacggccggctgcgc
gtgctcgacgcaaaagtgtcgttcgacaacaacgcgctgttccgccacccggacgtgctc
gaactgcgcgacaccactgaagaggacgagaaggaaatcgaggcgtcgaaatacgacctc
gcctatgtcgcgctcgacggcaatatcggctgcatggtcaacggcgccggcctcgccatg
gcgacgatggacatcatcaagctctatggcgccgagcccgccaacttcctcgatgtcggc
ggcggtgcctccaaggagaaagtgacggcggcgttcaagatcatcaccaaggatccggcg
gtcaaaggcatactgatcaacatcttcggcggcatcatgaagtgcgacatcatcgccgag
ggcgtgatcgccgcggtcaaggaagtcgggctggaagtgccgctggtggtgcgtctggaa
ggcaccaatgccgaactcggcaagaagatcatcaacgacagcggcctcaacgtcgtgtcg
gccgatgatctcgacgacgcagccaagaagatcgtcgcggcggtgaagggctga

DBGET integrated database retrieval system