KEGG   Mesorhizobium japonicum MAFF 303099: mll5025Help
Entry
mll5025           CDS       T00043                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00010  Glycolysis / Gluconeogenesis
mlo00030  Pentose phosphate pathway
mlo00051  Fructose and mannose metabolism
mlo00052  Galactose metabolism
mlo00680  Methane metabolism
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01120  Microbial metabolism in diverse environments
mlo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mll5025
   00030 Pentose phosphate pathway
    mll5025
   00051 Fructose and mannose metabolism
    mll5025
   00052 Galactose metabolism
    mll5025
  Energy metabolism
   00680 Methane metabolism
    mll5025
Enzymes [BR:mlo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     mll5025
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     mll5025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: BAB51545
RhizoBase: mll5025
UniProt: Q98CS6
Position
complement(3978826..3979992)
Genome map
AA seq 388 aa AA seqDB search
MAGTFIIAQGGGPTAVINQTVVGATLEIRKRHPGAKVLGSIHGVRGIRDGNYVDLSAIPE
DRLRLIAGTPSAALGSTRDKPDAAYCDVILKGLKKAGADAFIYIGGNDTSGTQQILTDAA
GGSIAFVHAPKTIDNDLEENDHTPGFISAAEFVAGAFLSVDLDFRALPGIYVGIVMGRHA
GFLTAAAAAWQLDPDSGPHLVYVPERPFSAAGFIDDVRATLDRHKRCIVAVSEGVSTADG
KALVESLVPPEKLERDAHGNVKLSGSDLPAALERALAEGLPGKRARVDALGYMPRGYVGA
ISAVDAQEAFDAGAFAVSVAEQGGGSVALQYDGTKTVLKKVPLKNVAGKTRHMPDDFMKP
DVNQLSEAGMAYLKRLVPEKYKVGKPFV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggccggaacttttatcatcgcgcagggcggcggcccgaccgccgtcatcaaccagacg
gtggtcggcgccacgctggagatccgcaagcggcatccgggcgccaaggtcctgggctcc
atccatggcgtgcgcggcatccgcgacggcaattatgtcgacctctcggccatccccgag
gatcggctgcggctgatagcgggaacgccaagcgccgcccttggctcgacgcgcgacaag
ccggatgccgcctattgcgacgtcatcctcaaaggcctgaagaaggccggcgccgacgcc
ttcatctatatcggcggcaacgacacgtcgggcacgcagcagatcctgaccgatgccgcc
ggcggctcgattgctttcgtccatgcacccaagaccatcgacaatgatctggaggagaac
gaccacacgccgggcttcatctcggcggccgagttcgtcgccggcgccttcctctccgtc
gatctcgatttccgcgctttgcctggcatctatgtcggcatcgtcatgggccggcatgcc
ggttttctcaccgcggcggcggccgcctggcagctcgatcccgacagcggcccgcatctg
gtctatgtgccggagcggccgttctcggccgccggcttcatcgatgatgtgcgcgccacg
cttgaccggcacaagcgctgcatcgtcgccgtgtcggaaggggtaagcaccgccgacggc
aaggcgctggtcgaaagcctggtgccgccggagaagctcgagcgtgacgcccatggtaac
gtcaagctgtcgggcagcgacctgccagccgcgcttgagcgcgcgctggccgaaggcctg
cccggcaagcgggcccgcgtcgacgcgctcggctacatgccgcgcggctatgtcggcgcc
atcagcgccgtcgacgcgcaggaggcgttcgatgccggcgccttcgccgtctccgtcgcc
gaacagggcggcggctcggtggcgctgcagtatgacgggacaaagacggtgctgaaaaag
gtgccgctgaagaatgtcgccggcaagacccgccacatgcctgacgatttcatgaagccc
gacgtcaaccagctgtccgaagccggcatggcctatctcaagcggctggtgccggaaaag
tacaaggtcgggaagcctttcgtttaa

DBGET integrated database retrieval system