KEGG   Mesorhizobium japonicum MAFF 303099: mll5862Help
Entry
mll5862           CDS       T00043                                 

Definition
(GenBank) nitrogen fixation protein; FixA
  KO
K03521  electron transfer flavoprotein beta subunit
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    mll5862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ETF LDB19 SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: BAB52238
RhizoBase: mll5862
UniProt: Q98AT4
Position
complement(4735048..4735899)
Genome map
AA seq 283 aa AA seqDB search
MHIVICIKQVPDSAQIRVHPVTNTIMRQGVPTIINPYDLFALEEALRLRDAHGGEVTVLT
MGPPMAEDALRKALTYGADRAVLLTDRCFAGSDTLATSFALSRAIVRIGETFGAPDIVFA
GKQTIDGDTAQVGPGIAKRLGLLQFTYVAKIDSIDVDAREITVKRRSEGGTQMLKSRLPC
LITMLEGTNEIRRGSLEDAMRAARSQIVKWSAAEAGIEDLNKCGLRGSPTVVKRVFAPTT
RAEKATQIDMTDKTQHDLADELIASIFTRQPALEHELAFDGGQ
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcacattgtaatctgtatcaagcaggtgccggactccgcgcagatacgtgtccacccg
gtgacgaacacgatcatgcgccagggcgtgccgaccatcatcaacccttacgacctgttc
gccctcgaagaggcactgagattgcgcgacgcccatggcggcgaggtcaccgtgcttacg
atgggtccgccgatggcagaagatgcgctgcgcaaggcgctcacctatggcgccgaccgc
gcggtactcttgaccgaccgctgttttgccggctccgacacgctggcgacctccttcgcg
ctttctcgggcaatcgtgagaattggcgagaccttcggcgcgccggacatcgtcttcgcc
ggcaagcagacgattgacggcgataccgcccaggtcgggcccggcatcgccaagcgcctc
ggcctcctgcagttcacctatgtggcgaagatcgactctatcgatgtcgatgctcgcgag
atcaccgtcaagcgccgttcggaaggcggtacgcagatgctgaaaagcaggctgccttgc
ctcatcacaatgctggaaggcaccaacgaaatccgcagaggctcgctcgaggacgccatg
cgcgccgcgcgcagccagatcgtgaaatggagcgcggccgaagctggcattgaggacctc
aacaaatgcggcctgcgcggctcgccgacggtcgtcaagcgcgttttcgcccctaccacg
cgggcggaaaaggcgacgcagatcgacatgaccgacaagacgcagcacgacctcgctgac
gaactgatcgcctcaatctttacccgccagccagcgctggaacacgaactcgccttcgac
ggcggccagtga

DBGET integrated database retrieval system