KEGG   Mesorhizobium japonicum MAFF 303099: mll5872Help
Entry
mll5872           CDS       T00043                                 

Definition
(GenBank) RNA polymerase sigma-54 factor; RpoN
  KO
K03092  RNA polymerase sigma-54 factor
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    mll5872
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mlo03021]
    mll5872
Transcription machinery [BR:mlo03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     mll5872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_DBD Sigma54_CBD Sigma54_AID HTH_38 HTH_3
Motif
Other DBs
NCBI-ProteinID: BAB52246
RhizoBase: mll5872
UniProt: Q98AS6
Position
complement(4742055..4743509)
Genome map
AA seq 484 aa AA seqDB search
MESSASLLQRQKQSLVLTPQMMESIRLLQLAHPELHQFVEQEIEKNPFLERASNRAPKDI
PSISAGNPRIGPTTGGISDRASQWKSIRGKNNVQPGGNHAFEDSWTSIETLHDHVARQIA
LSAFAPLERRIAGELAGHLEDTGYLPVNLSELARSLNVREAVVERVLGTLQQFDPPGIFA
RTLSECLEIQLRQLDRFDPAMAALVANLEALARRDFQTLKRHCGVDEDDLLDMLHEIRAL
DPKPGNRFQSGGPESIIPDVLVQPSPGGGWQIELNPDTLPRLLMNQNYFAQVSRLSAQNS
KDQSFLNECLQNANWLIRSLDQRAKTILKVAAEIIRQQDAFFEHGVAHLRPLNLRTVADA
INVHQSTVSRVTSNKYMLTPRGVFELKYFFTVAIGSSEGGDAYSAEAVRHQIKAMVAVES
PNEVLSDDDIATRLKETGIDIARRTVAKYREALNIPSSARRRREKRVRLRCQSSPVGGGD
ESGS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctcagcaagcctgcttcagcgtcagaagcaatcgttggttttgacgccgcaa
atgatggaatccattcgcctgttgcaactggcgcatcccgaactgcatcagttcgtcgag
caggaaatcgagaagaacccctttctggaacgggcctcaaaccgggcgccgaaggacatt
ccgtcgatttcggccgggaacccgcgcatcgggccgaccacgggcggaatatcggatcgg
gcctcgcagtggaaatcaatccgcggcaaaaacaatgtccaaccggggggaaaccatgcg
ttcgaagattcctggacgtccatcgaaacattgcacgaccatgtcgctcgtcagatcgct
ctcagcgcattcgcgccgctggagcggcgaatagctggcgagcttgccggtcatctggaa
gacaccggataccttccggtgaacctttcggaactggcccgcagcctgaatgtccgggag
gctgttgtggaacgggttctcggaaccttgcagcagttcgatccaccgggtatttttgcg
cgaactctcagcgaatgccttgagatacaattgcggcagctagacaggttcgacccggca
atggcagcgctggtcgccaatcttgaagcgctggcgcgacgcgattttcaaacattgaag
cgccattgcggtgtcgatgaagacgaccttctcgacatgttgcacgaaatccgcgcgctc
gatcccaagcccggaaaccgattccaatccggagggcctgaatcgatcattcccgacgtc
ttggtccagccctctcccggaggtgggtggcaaatcgaactcaatccagacacgctgcct
aggctgctgatgaaccaaaactattttgcccaggtctcccgcctaagcgctcaaaattcg
aaagatcagtcatttctcaacgaatgcctccaaaacgcgaactggctaatccgcagcctt
gatcagcgcgccaagacgatcctcaaggtagcggctgaaatcatccgccagcaggacgcc
ttttttgaacatggggtcgcccacctgcggcctctcaatctcaggactgtcgcggatgcg
atcaacgtgcaccagtcgacggtaagccgggtaacgtcgaacaagtacatgctgaccccg
cgcggcgtgttcgaactgaagtattttttcactgtcgcgatcggctcctccgaaggcggc
gacgcgtactccgccgaagctgtccgccatcaaatcaaggcgatggttgccgtggaatcg
cccaacgaagtgctttcagacgacgacattgccacccggctcaaggaaaccgggatcgac
attgctcgccgcaccgttgcgaaatatcgtgaggcgctgaacatcccgtcctccgcgcga
cgtcgccgggaaaagcgcgtgcgtcttcgatgccaatcaagcccggtcggcggcggcgac
gaaagcggctcttaa

DBGET integrated database retrieval system