KEGG   Mesorhizobium japonicum MAFF 303099: mll5873Help
Entry
mll5873           CDS       T00043                                 

Definition
(GenBank) peroxiredoxin 2 family protein
Organism
mlo  Mesorhizobium japonicum MAFF 303099
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: BAB52247
RhizoBase: mll5873
UniProt: Q98AS5
Position
complement(4743584..4744132)
Genome map
AA seq 182 aa AA seqDB search
MTVKKKVPFVTFRTRVRDDSIEGPNPYRWEDKTSDDYFRGKRIILFSLPGAFTPTCSTLQ
LPDFEMLYDEFEKEGIDAIYCVSVNDAFVMNAWGKALGLQKVQLIPDGSGEFTRKMGMLV
AKDNLGFGMRSWRYAAVINNGVVEQWFEEDGFCDNCEADPYGVSSPQNVLETLRAAKAVT
AA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaaaaaaaaggttcctttcgtcacctttcgcacgcgtgttcgcgatgactcc
atcgaggggccaaacccgtaccgctgggaagacaagacatccgacgactatttccgcggc
aagcgcatcatcctgttctcgctgcccggtgccttcaccccgacctgctcgaccttgcag
ttgcccgatttcgaaatgctctacgacgagttcgagaaggagggaattgacgcgatctac
tgcgtttccgtcaacgatgccttcgtcatgaatgcctggggcaaggccctggggctgcag
aaagtccagctcatcccagacggctcgggcgagttcacccgcaagatgggcatgctggtt
gccaaggacaatctcggcttcggcatgcgctcctggcgctacgctgccgtgatcaacaat
ggcgtagtggagcagtggttcgaggaggacggtttctgcgacaactgcgaggccgatccc
tatggcgtatcgtcgccgcagaacgtccttgaaacgttgagagccgccaaagccgtgacg
gctgcatga

DBGET integrated database retrieval system