KEGG   Mesorhizobium japonicum MAFF 303099: mll6303Help
Entry
mll6303           CDS       T00043                                 

Definition
(GenBank) hypothetical protein
Organism
mlo  Mesorhizobium japonicum MAFF 303099
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3800
Motif
Other DBs
NCBI-ProteinID: BAB52621
RhizoBase: mll6303
UniProt: Q989S3
Position
complement(5117971..5118849)
Genome map
AA seq 292 aa AA seqDB search
MQPPVFAPSCTDNESLPVTDREIHLYLDDSGSREPDREPKEKRRDEMDYFALGGILINEE
DVDELYARHKAFCQKHGITYPLHSWAIRGGRGDFGWLKKPESAFEFLGDLQGMLLALPVI
GIAAVIDRPGYVARYRDRYQDQLWFMCKTAYCILIERAAKYARSQDRKLRVFFERAGKAE
DRDLIAYTRILKTQGMPFDGVNSASYGSLTAEEFKDIVRGEPRGRTKATPMLQIADLYLY
PMAKGGYDPSYRPYRALMDHKRLIDAHLPPEDLASCGIKYSCFERIKNKDPD
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctccggtttttgcgccaagctgtacggacaatgaaagcctgcccgtgacagac
cgtgaaatccacctctacctcgatgacagcggcagccgcgagccagaccgagagcctaaa
gagaagcgccgggacgaaatggactatttcgccctcggcggcatcctcatcaacgaggaa
gacgtcgatgagctctatgcccgccacaaggccttctgccagaagcacggcatcacctac
ccgctccactcctgggccatccgcggcggccgtggcgacttcggctggctaaagaagccg
gagtccgcttttgaattcctgggcgatctgcaggggatgcttctcgcgctgcccgtgatc
ggcatcgccgcggtgatcgaccgaccgggctacgttgcccgttaccgggaccggtatcag
gatcagctctggttcatgtgcaagaccgcctactgcatcctgatcgagcgcgccgccaaa
tatgcccgcagccaggaccgcaagctgcgcgtgttcttcgagagggctggcaaagccgag
gaccgcgacctgatagcctacacgcggatcctgaagacgcaggggatgccgttcgatggc
gtcaactccgccagctacgggtcattaaccgctgaggagttcaaagacatcgtgcgcggg
gagccgcgcggcagaaccaaagccacgccgatgttgcagatcgccgatctctacctctat
ccgatggccaagggcggctatgacccgtcctaccggccctacagggccctgatggaccac
aagcgtctcatcgacgcgcacctgccgcccgaggacctggcatcctgcggcatcaaatac
agctgttttgaacggataaaaaacaaagacccggactag

DBGET integrated database retrieval system