KEGG   Mesorhizobium japonicum MAFF 303099: mll7422Help
Entry
mll7422           CDS       T00043                                 

Definition
(GenBank) isopentenyl monophosphate kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00900  Terpenoid backbone biosynthesis
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    mll7422
Enzymes [BR:mlo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     mll7422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: BAB53527
RhizoBase: mll7422
UniProt: Q986C6
Position
complement(6133521..6134408)
Genome map
AA seq 295 aa AA seqDB search
MDTDIGSRTWHAHAKINLALHVTGRRADGYHLIDSLAVFTRFGDRVEIALADSDDFTVSG
RYAPAVPLDAGNLVLKARDALRREAGSGRTPPVSIKLEKNLPIASGVGGGSSDAAAVLRG
LAQTWALDIDDAGLARIGLSLGADVPMCLAAKPLVARGIGDELSMVPDFSALGLVLVNPG
TPVSTADVFAALSRRDNEPLPPLPRSIDFHSLRNWLEVTRNDLEPAALALQPAIGRALSW
LNKAGSGFSRMSGSGATCFGLFETGNVAKRAAAEIRSRQPDWFVAATRSMSSEAE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtggacaccgacatcggttcgcgcacctggcacgcgcatgccaagatcaatctggcgctg
cacgtcaccggcaggcgtgctgacggctaccatctgatcgacagcctggcggtgttcacg
cgcttcggcgacagggtcgagatcgccctcgccgacagcgacgatttcaccgtatccggc
cgttatgccccggcggttccgctcgacgccggcaatcttgtgctcaaggcgcgcgatgcc
ttgcggcgggaggccggctccgggcgcaccccgccggtctcgataaagctggaaaagaac
ctgccgatcgcctccggcgttggcggcgggtcgagcgatgcagcggccgtgttgcgcgga
ctggcacagacatgggccctggacatcgacgacgccgggctggcgcggatcggtctctcg
cttggcgccgacgtgccgatgtgccttgcggcaaagccgctggtggcgcgcggcattggt
gacgagctgtcgatggtaccggacttttcagcgctggggctggtcctggtcaatccaggc
acgccggtctcgacggcggatgtcttcgcggccctgtcccgccgcgacaacgagcccctg
ccgccgctgccgcgcagcatcgatttccacagcctgcgcaactggctggaggtcacccgc
aatgatctggagcctgcagcccttgcgctgcagcccgccataggcagggcgctatcatgg
ctcaataaggccggatcgggattttcacgcatgtcgggatcgggcgcgacttgtttcggc
ctgttcgagaccggcaatgtcgccaagcgcgcggcggccgaaatccgcagccgccagccc
gactggttcgtcgcggcgacgcgcagcatgtcatcagaggctgagtga

DBGET integrated database retrieval system