KEGG   Mesorhizobium japonicum MAFF 303099: mll7917Help
Entry
mll7917           CDS       T00043                                 

Definition
(GenBank) nucleoside-diphosphate-kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00230  Purine metabolism
mlo00240  Pyrimidine metabolism
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01130  Biosynthesis of antibiotics
Module
mlo_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mlo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
mlo_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    mll7917
   00240 Pyrimidine metabolism
    mll7917
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mlo04131]
    mll7917
Enzymes [BR:mlo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     mll7917
Membrane trafficking [BR:mlo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    mll7917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK DUF4192
Motif
Other DBs
NCBI-ProteinID: BAB54275
RhizoBase: mll7917
UniProt: Q984N8
Position
complement(6539960..6540382)
Genome map
AA seq 140 aa AA seqDB search
MALERTFSMIKPDATRRNLTGAITKMLEDAGLRVIASRRVWMSRREAEGFYAVHKDRPFF
GELVEFMSSAPTIVQVLEGENAIARNREVMGATNPANAAEGTIRKVHALSIGENSVHGSD
APETAAQEIKYWFSDTEIVG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgaacgcaccttttccatgatcaagccggacgctacccggcgcaacctcacc
ggcgccatcaccaagatgctggaagacgccggcctgcgcgtcatcgcttcgcgccgcgtc
tggatgagccgccgtgaggcggaaggtttctacgccgtccacaaggaccgccctttcttc
ggcgaactggtcgagttcatgtcgtcggctccgacgatcgtccaggtgctggaaggcgag
aacgccattgccaggaaccgcgaagtgatgggcgccaccaacccggccaacgccgccgaa
ggcaccatccgcaaagtgcacgcgctgtcgatcggcgagaattcggtgcacggctccgac
gcgccggaaaccgcggcgcaggagatcaagtactggttctcggacaccgagatcgtcggc
tga

DBGET integrated database retrieval system