KEGG   Mesorhizobium japonicum MAFF 303099: mlr1178Help
Entry
mlr1178           CDS       T00043                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00010  Glycolysis / Gluconeogenesis
mlo00071  Fatty acid degradation
mlo00350  Tyrosine metabolism
mlo00625  Chloroalkane and chloroalkene degradation
mlo00626  Naphthalene degradation
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01120  Microbial metabolism in diverse environments
mlo01130  Biosynthesis of antibiotics
mlo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mlr1178
  Lipid metabolism
   00071 Fatty acid degradation
    mlr1178
  Amino acid metabolism
   00350 Tyrosine metabolism
    mlr1178
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    mlr1178
   00626 Naphthalene degradation
    mlr1178
Enzymes [BR:mlo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     mlr1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 PALP NADH_4Fe-4S Limkain-b1 CMAS adh_short
Motif
Other DBs
NCBI-ProteinID: BAB48613
RhizoBase: mlr1178
UniProt: Q98L50
Position
990254..991282
Genome map
AA seq 342 aa AA seqDB search
MRALQLIEDRRLETVDLPPPPPPALGEVTLRIRAVALNHIDVWGWRGMAFAKRKLPLVVG
AEASGEVEAVGPGVSSLLPGQLVSIYGARTCGLCRACREGRDNLCEHVSGVHGFHLDGFA
QEKINLPARLLVPAPPGVSDIGAAVAPVTFGTVEHMLFDNARLQPGETILVHAGGSGIGS
AAIQLAKRMGCTIITTVGSNDKIDKAKALGADHVINYREDRFEGVVRKLTKKKGVDVVFE
HVGADTFAGSMLCLKRGGRLVTCGSTSGVSTQINLMQLFQQQLKLLGSFGCRMENMANAM
QKMAAGQVAPVIDTEVGFDDIDAALKRMEGRDVFGKIILRVA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcactgcaacttatcgaggaccgccgtcttgaaacggtggacctgccgcctccc
ccgccacccgcgctcggcgaagtcacgctgcgcatcagggcggtggcgctgaaccacatc
gacgtctggggctggcgcggcatggccttcgccaagcgcaagctgccgctggtcgtcggc
gccgaagcctccggcgaggtcgaggcggtcggccccggcgtgtccagcctgctgcccgga
caattggtgtcgatctatggcgcgcgcacctgcggcctttgccgtgcctgccgcgaaggc
cgcgacaatctttgcgaacatgtttccggggtccacggcttccacctcgacgggtttgcg
caggagaagatcaacctgccggcgcgcctgttggtccccgccccgcccggcgtgagcgac
atcggcgccgcggtggcccccgtcaccttcggcacggtcgagcacatgctgttcgacaac
gccaggcttcagccgggcgaaaccatcctcgtccatgccggcggctccggcattggctcg
gcggcgatccagctggccaagcggatgggctgcaccattatcaccaccgtcggttccaac
gacaagatcgacaaggccaaggcgctcggcgccgaccacgtcatcaactaccgcgaagac
cgcttcgaaggcgtcgtgcgcaagctaaccaagaagaagggcgtcgacgtcgtcttcgaa
catgtcggcgccgacacctttgccggctcgatgctgtgcctgaagcgcggcggccgccta
gtgacctgcggctcgacatcaggcgtgtcgacgcaaatcaacctgatgcagctcttccag
cagcaattgaagctgctcggctccttcggctgccgcatggagaacatggccaacgccatg
cagaaaatggcggcgggacaggtcgcgccggtcatcgacaccgaagtcggcttcgacgat
atcgacgcagcgctaaagcgcatggaaggccgcgacgtcttcggcaagatcatcctgcgc
gtcgcctga

DBGET integrated database retrieval system