KEGG   Mesorhizobium japonicum MAFF 303099: mlr2337Help
Entry
mlr2337           CDS       T00043                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mlo02044]
    mlr2337
Secretion system [BR:mlo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   mlr2337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA Peripla_BP_2 Dimer_Tnp_Tn5
Motif
Other DBs
NCBI-ProteinID: BAB49491
RhizoBase: mlr2337
UniProt: Q98IM5
Position
1886602..1887138
Genome map
AA seq 178 aa AA seqDB search
MPAESKAKVIERNRAPRVQIAYDVETYGSPTTIELPFVMAVMADLSGASQTKEASKSVLD
RNFVETDANRFPKFMEAMGPRVKARVKNTLPQAEGAERDEELAIDLTFSKMGDFAPDKVA
EQVPQLAEILKMRRQLEELLGFMDGRVDAEKRIAQLLNNEPLLSKIASQAISDGKGEE
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgccagcagagagcaaagccaaggtcatcgaaagaaaccgcgccccgcgcgtgcagatc
gcctacgacgtcgaaacctacggcagccccacgacgatcgagttgccgttcgtcatggct
gtcatggccgacctttccggcgcctcgcagaccaaggaagcgtcgaagtcggttctggac
cgcaatttcgtcgaaaccgacgccaatcgcttccccaaattcatggaagcgatgggacca
cgcgtgaaggcgcgcgtgaagaacacgttgccgcaagccgaaggcgccgagcgggacgag
gaactggcgatcgatctcaccttttccaaaatgggcgatttcgcgcccgacaaggtcgcc
gagcaggtgccgcaactggccgagatcctcaagatgcggcgtcagcttgaggaactgctg
ggcttcatggatggccgggtcgacgccgaaaagcgcatcgcgcagcttctgaacaacgag
ccgctgctgagcaagatcgccagccaggcgatttctgacggcaagggcgaggagtaa

DBGET integrated database retrieval system