KEGG   Mesorhizobium japonicum MAFF 303099: mlr2343
Entry
mlr2343           CDS       T00043                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mlo02044]
    mlr2343
Secretion system [BR:mlo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   mlr2343
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: BAB49496
RhizoBase: mlr2343
UniProt: Q98IM0
Position
1891758..1892825
AA seq 355 aa
MADDARQSLPDLAESATVAAEPLLESFDFFELLRRLEQRRGLFGHSGTADREPARLGQHV
RLSFSARDVIKLQDAGEKAPARVTVANLGLLGPEGPMPLHLTRWVLDRLSQRWFTGADAE
QTSDTTFVDFVNILQHRMMALYYRAWADAHPAVQVERSVGGRVRAMLEAMSGIGLPGTQD
PELDTVRLRQAGSLASQIDGAERLTQFLATAFKVPVQIKEFVAAWISIPAALQTRLGKAH
AGLGRGATIGPRVFSRQSRIELRVGPLSLDDFRSFLPGERRLGLFKKAVRDMIGETLDVD
LRIVLARDAVPSPQVGTVQLGRTAWLARPADRGDADDLRLHTIVGWRPQMAEAAA
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggccgatgacgcccggcaatcgctacctgatctagcggagtccgcaacggtcgcggcc
gaaccgttgctggagagcttcgactttttcgagctgttgcggcgcctggagcagcgccgt
ggattgttcggccattccggaacggccgaccgcgagccggcaagacttggccagcatgtg
cgcctgagcttctcggcccgcgacgtcatcaagctccaggacgccggggagaaggccccc
gcgcgggtgaccgtcgccaatctcgggctgcttgggccggaaggaccgatgccattgcac
ctgacacgctgggtgctcgaccggctgtcgcagcgctggttcaccggggccgatgccgag
cagaccagcgacacgaccttcgtcgatttcgtcaacatcctgcagcaccgcatgatggcc
ctttactatcgcgcctgggctgacgcgcatccggcggtgcaggtcgagcggtccgtcggc
gggcgtgttcgcgccatgctggaggcaatgtccgggatcggtctccccggcacccaggat
cccgaactcgacactgtgcgactgcgacaggctggatcgctcgccagccagatcgacggc
gcggagcggctgacgcagtttctcgccaccgccttcaaggtgccggtgcagatcaaggaa
ttcgtcgccgcttggatcagcattccggcggcactgcagacgcgtctcggcaaggcccat
gccgggctcggacgcggcgcgacgatcgggccgcgggtcttcagccgccaaagcaggatc
gaactgcgcgtcggtccgctgagcctcgacgacttcaggtcgttcttgcccggcgaacgg
cgtcttggcctgttcaagaaggcggtgcgcgacatgatcggcgagacgctcgacgtcgat
ttgcgcatcgtgctcgcgcgcgacgccgtgccgtcgccacaggtcgggaccgtccagctt
ggccggaccgcctggctggcacgtcccgccgacaggggtgatgccgacgatctcagattg
cacaccatcgtcggctggcggccgcaaatggcggaggcggccgcatga

DBGET integrated database retrieval system