KEGG   Mesorhizobium japonicum MAFF 303099: mlr2358
Entry
mlr2358           CDS       T00043                                 

Definition
(GenBank) hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mlo02044]
    mlr2358
Secretion system [BR:mlo02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   mlr2358
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: BAB49510
RhizoBase: mlr2358
UniProt: Q98IK6
Position
1909132..1910211
AA seq 359 aa
MFITLQISNVDRLPPGIAASYAARDRSFEIGRENCDWTLSDPDKFISGRHCEIRYQAGTF
WLHDVSRNGTFVNGSSQRMNAPHRLTQGDRLLIGRYVVAVSVDEERVATGHPQARTGSTQ
RELPPSTGTPLKLGSALFHNLGEQRPAEVTPVPASSVLQSSPAVPAKQPGEAEGILRDIA
RAAGLSPELLQSRDPHDVAAEIGAVLRTTVEQLSLLLKARAAAKVLAKSAHRTMIGAEDN
NPLKFVPGTDDILEIMFAKRRAGYLDARHSIEDAFRDLKTHEIATYAAMQAALSRLLDDL
SPEAIAKRIPPASFSSRKSQAWDALVATWRTMEDKHENGMLDVFLAYFAEAYAKADKQK
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgttcattacactccagatcagcaatgttgacaggctgccaccaggcatcgcggcgagc
tatgccgcgcgcgaccgcagcttcgaaatcgggcgcgaaaattgtgactggacactttcc
gatcccgacaagttcatctcgggccggcactgcgaaatccgctatcaggccggcacgttc
tggcttcatgatgtctcgcgcaacggcaccttcgtcaacggctccagccagcgcatgaat
gcgccgcatcggctaacccaaggcgaccggctgctgatcggccgctacgtcgtcgccgtt
tcggtcgacgaagagcgcgtcgccaccggtcatccgcaagccaggaccggttcgacgcaa
cgcgagttgccgccctcgacggggacaccgctgaaactcggcagcgcgttattccacaat
ttgggggagcagcgcccggccgaggtaacgccggtgccggcgtcttctgtgctgcagtcc
agccccgctgtcccggccaagcagccaggggaagcggaggggatactgcgcgatatcgcc
agggccgccggcttatcgccggagttgttgcagtcgcgcgacccgcatgacgtcgctgcc
gagatcggtgcggtgttgagaaccacggtcgagcaactgtccttgctgctcaaggcgcgc
gccgcggccaaggtgctcgccaaaagcgcgcaccgcaccatgatcggcgccgaggacaac
aacccgctgaaatttgtgccgggcaccgacgacatactcgagatcatgtttgccaagcgc
cgggccggctatctcgatgccagacacagcatcgaggatgcgttccgagacctgaagacc
cacgaaatcgctacctacgcagccatgcaggccgcgctctcgaggctgctcgacgacctg
tcgccggaggcgatcgccaaaagaatcccgcctgcgtccttttcgtccaggaaaagccag
gcctgggacgcgctcgtcgcaacgtggcggacgatggaggacaagcacgaaaacggcatg
ctggatgtcttcctcgcttatttcgccgaagcctacgccaaggctgacaagcagaaatag

DBGET integrated database retrieval system