KEGG   Mesorhizobium japonicum MAFF 303099: mlr2860Help
Entry
mlr2860           CDS       T00043                                 

Definition
(GenBank) nitrate transporter component; NrtB
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00910  Nitrogen metabolism
mlo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    mlr2860
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    mlr2860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mlo02000]
    mlr2860
Transporters [BR:mlo02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter
    mlr2860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: BAB49885
RhizoBase: mlr2860
UniProt: Q98HI1
Position
2295809..2296705
Genome map
AA seq 298 aa AA seqDB search
MSIQAIEDTKVKAFPAPAKPAEVIAFAAKARRRFDPLAIAGKLASTLVPPVIVIALMLVV
WQVACSSPTSSLPPPSQVWNEAYDLIAHPFFDNGPQDIGLAWRVLISLQRVAIGFGLAAI
VGVALGALVGQSIWAMRGLDPVFQILRTVPPLAWLPLSLAAFRDSSPSALFVIFITSIWP
IIINTAVGVRNIPQDYRNVARILRLNPFEFFVKIMVPAAAPYIFTGLRIGIGLSWLAIVA
AEMLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGVTGFCLDRLVAGVGVFVTRGTTAK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccaagctatcgaggacaccaaggtgaaggcgtttcccgcgccggccaaaccg
gccgaggtgatcgccttcgccgccaaggcgcggcgccgcttcgacccgctcgccatcgcc
ggcaagctggcgagcacgctggtgccgcccgtcatcgtcatcgctctgatgctcgtcgtc
tggcaggtcgcctgctcgtcgcccacatcgagcctgccgccgccgagccaggtgtggaac
gaggcctacgatctcatcgcgcatccgttcttcgacaatggcccgcaggacatcgggctg
gcctggcgggtgctgatctcgttgcagcgcgtcgccatcggctttggcctggcggcgatc
gtcggcgtcgcgctcggcgcgctggtcggccagtcgatctgggcgatgcgcggcctcgat
ccggtgttccagatcctgcgcaccgtgccgccgctcgcatggctgccgctgtcgctggcg
gcgttccgcgattccagcccgtcggcgctgttcgtcatcttcatcacctcaatctggccg
atcatcatcaacaccgccgtcggcgtgcgcaacatcccgcaggattaccgcaacgtcgcg
cgcatcctgcggctcaacccgttcgagttcttcgtcaagatcatggtgccggccgccgcg
ccctacatcttcaccggtctgcgcatcggcatcggcctgtcctggctcgccatcgtcgcc
gccgaaatgctgaccggcggcgtcggcatcggcttcttcatctgggacgcgtggaactcg
tcgcggctgcccgacatcatcgtcgcgctcgcctatatcggcgtcaccggcttctgcctc
gaccgcctggtcgccggcgtcggcgtcttcgtcacccgcggcacaacggcaaagtga

DBGET integrated database retrieval system