KEGG   Mesorhizobium japonicum MAFF 303099: mlr4209Help
Entry
mlr4209           CDS       T00043                                 

Definition
(GenBank) similar to phosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00010  Glycolysis / Gluconeogenesis
mlo00520  Amino sugar and nucleotide sugar metabolism
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01120  Microbial metabolism in diverse environments
mlo01130  Biosynthesis of antibiotics
mlo01200  Carbon metabolism
Module
mlo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mlr4209
   00520 Amino sugar and nucleotide sugar metabolism
    mlr4209
Enzymes [BR:mlo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     mlr4209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: BAB50919
RhizoBase: mlr4209
UniProt: Q98EJ9
Position
3363122..3363844
Genome map
AA seq 240 aa AA seqDB search
MSGGDAMAKAVKQPAPDAEQIVLAIDIGGSHVKILTSAGGAERRDDSGPDLTPQQMIDKV
KKLAEGLSYDVISMGYPGPVRHNKPVLDPKNLGKGWAGFDFAAQFGKPVKVVNDALMQAI
GSYEGGRMLFLGLGTGLGAAMVFDNVGQPMELAHLPYRKGRSFEDYVGERGLEKRGKKKW
RKYVFDVVTRLRAALQPDYVVIGGGNVDKLDALPAEARRGDNTRAFEGGFRLWRDKALIV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaggggacgcgatggccaaggcggtgaagcaaccggcacccgacgccgagcag
atcgttctggcgatcgacattggcggctcgcacgtcaagatcctgaccagcgccggcggc
gccgagcgccgggacgattccggcccggacctgacgccgcagcagatgatcgacaaggtg
aagaaactcgccgagggcctgtcctacgacgtcatctcgatgggctatcccggcccggtg
cgtcacaacaagccggtgctcgaccccaagaatctcggcaagggctgggccggcttcgat
ttcgccgcgcaattcggcaagccggtcaaggtggtcaatgatgcgctgatgcaggccatc
ggcagctatgaaggcgggcgcatgctgttcctcgggctgggaaccggcctcggcgcggcg
atggtcttcgacaatgtcggccagccgatggaactcgcccatcttccctacagaaaaggc
cgcagtttcgaggactatgtcggcgagcgcggcctggaaaagcgcggcaagaagaagtgg
cgcaaatacgtcttcgacgtcgtcacccggctgcgcgccgccctgcaaccagactatgtc
gtcattggcggcggcaatgtcgacaagctcgacgcgttaccagccgaggccaggcgcggt
gacaacacacgcgccttcgaaggcggatttcgtctgtggcgagacaaggccctgattgtc
tga

DBGET integrated database retrieval system