KEGG   Mesorhizobium japonicum MAFF 303099: mlr4790Help
Entry
mlr4790           CDS       T00043                                 

Definition
(GenBank) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00260  Glycine, serine and threonine metabolism
mlo00630  Glyoxylate and dicarboxylate metabolism
mlo00670  One carbon pool by folate
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01130  Biosynthesis of antibiotics
mlo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    mlr4790
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mlr4790
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    mlr4790
Enzymes [BR:mlo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     mlr4790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: BAB51367
RhizoBase: mlr4790
UniProt: Q98DA4
Position
3810590..3811717
Genome map
AA seq 375 aa AA seqDB search
METFLAERRSPFYSSIVGLGATMGRVGGDFISAKYYSGVTDEHLNTRANVGVQDLSTMGK
MDIKGPDAEALVNHVIVNDAVAMKPGQVRYSTVCREDGGIMDDLTVFRLGPEHFMLVTGS
VNRLKMLPWLQHHAQGRKAYVTDITAAVAFPTIQGPRSRELLKAMISDADLDGLKRWAFT
SGHVNGTRVLISRTGVTGELGFELFVPADEAASVWDTLMRAGKDFGLKPYGVLAMFTLGL
EKAYPAHGIDMDETRTPFHVGLDRWIKFDKGDFIGREALLKIRDKGLDERWTGLILDGNK
PAATDARVLADGEDAGIVTYSDHGYSLGKVLATAHLRLPFTAIGTELSIDIDGRPTRAVV
APMPFFDPEGVRLRG
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggagaccttcttggctgagcggcgttcccccttctacagcagcatcgtcgggctcggt
gcgaccatgggtcgggtcggcggcgatttcatctcggccaaatactattccggcgtcacc
gacgagcacctgaacacgcgcgccaatgtcggcgtgcaggatctcagcaccatgggcaag
atggacatcaaggggccggacgccgaggcgctggtcaaccatgtcatcgtcaacgatgcc
gtggcgatgaagccgggccaggtccgctattccacagtctgccgcgaggatggcggcatc
atggacgaccttaccgtgttccggctggggccggagcatttcatgctggtcaccggctcg
gtcaaccgcctgaagatgctgccctggctgcagcaccatgcccagggccgcaaggcctac
gtcaccgacattaccgccgccgtcgccttcccgaccatccagggcccgcgttcgcgcgaa
ctgttgaaggcgatgatctcagatgccgatctggacggtctcaagcgctgggcgttcacc
tcaggccatgtcaacggcacgcgcgtcctgatctcccgcaccggcgtgaccggcgaactc
ggcttcgaactcttcgtgccggccgacgaggcggcctcggtctgggatacgctgatgcgg
gccggcaaggacttcggcctgaaaccctatggcgtgctggcgatgttcacgctcggcctg
gaaaaggcctatccggcgcatggcatcgacatggacgagacccgcacgccgttccatgtc
ggcctcgaccgctggatcaagttcgacaagggcgatttcatcggccgcgaagcgctgctc
aagatccgtgacaagggcctcgacgagcgctggaccgggctgatcctcgacggcaacaaa
ccggcggcgacggacgccagggttttggccgatggcgaggatgccggcatcgtcacctac
agtgaccacggctattccctcggcaaggtgctggccactgcgcatctgcggctgcccttc
acggccatcggcaccgaactcagcatcgacatcgacggcaggccgacccgcgcggtcgtg
gcgccgatgccgttcttcgatccggaaggggttaggttgagaggctag

DBGET integrated database retrieval system