KEGG   Mesorhizobium japonicum MAFF 303099: mlr5932Help
Entry
mlr5932           CDS       T00043                                 

Definition
(GenBank) 1-aminocyclopropane-1-carboxylate deaminase
  KO
K01505  1-aminocyclopropane-1-carboxylate deaminase [EC:3.5.99.7]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00270  Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    mlr5932
Enzymes [BR:mlo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.7  1-aminocyclopropane-1-carboxylate deaminase
     mlr5932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAB52295
RhizoBase: mlr5932
UniProt: Q98AM7
Position
4798304..4799317
Genome map
AA seq 337 aa AA seqDB search
MLEKFERYPLTFGLTPIEKLDRLGKHLGGKVEIYAKREDCNSGLAFGGNKLRKLEYVIPD
AIASDADTLVTVGGVQSNHTRMVAAVAAKIGMKCLLVHESWVPHEDVVYDRVGNILLSRI
LGAEVRLVDDGFDIGIRRSWEKALYEVKARGGRPYAIPAGASVHPNGGLGYVGFAEEVRA
QEEQLGFAFDYMVVCTVTGSTHAGMLVGFAKDGRQRNVIGIDASATPAKTKAQVLSIARH
TATLVELGSELAEDDVVLLEDYAHPRYGIPSEETKEAIRLCARLEGMITDPVYEGKSMQG
MIDLVQKGFFPAGSRILYAHLGGAPAINGYGYTFRNG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaaaattcgagcgttacccgctcacctttggactcacacccatcgagaagctc
gaccggctcggcaagcatctgggtggcaaggtcgaaatctacgccaaacgcgaggactgc
aactccggtctggcgttcggcggcaacaagctgcgcaagctcgaatacgtcatccccgac
gcgatcgcgtcagatgccgataccctggtcaccgtcggcggcgtgcagtccaaccacacg
cgcatggtcgccgccgtcgccgccaagatcggcatgaagtgtctcctggttcacgagagc
tgggttccacatgaggatgtcgtctacgaccgggtcggcaacattctcttgagccgcatc
ttgggcgcagaggtgcgtctggtcgacgatggctttgacatcggtatccgccgcagctgg
gaaaaagcgctctatgaggtcaaggcaaggggcggcaggccctatgcgataccggccggg
gcgtctgttcacccgaatggaggcctcggctatgtggggttcgcggaggaagtgcgcgcc
caggaggaacagcttgggtttgccttcgactacatggtcgtttgcacggtcaccggttca
acgcatgccggcatgctcgtcggattcgccaaggacggtcggcagcgcaacgtgatcggt
atcgatgcctctgctaccccggccaagaccaaggcgcaggtgcttagcattgcccgacat
acggcgaccctcgtcgagctcggatcggaacttgccgaggatgacgtggtgttgctcgag
gactacgcgcacccgcggtacggcattccatccgaggaaaccaaggaggcgatccgtctg
tgtgcgcggctcgagggtatgattaccgatcccgtctatgagggcaaatcgatgcaaggg
atgattgacctcgttcaaaaaggtttttttccagcgggctcgaggatactttacgcgcat
ctcggcggcgcgccggccatcaacggttatggctacacctttcgcaatggctga

DBGET integrated database retrieval system