KEGG   Mesorhizobium japonicum MAFF 303099: mlr5943Help
Entry
mlr5943           CDS       T00043                                 

Definition
(GenBank) L-2,4-diaminobutyric acid transaminase
  KO
K00836  diaminobutyrate-2-oxoglutarate transaminase [EC:2.6.1.76]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00260  Glycine, serine and threonine metabolism
mlo01100  Metabolic pathways
mlo01120  Microbial metabolism in diverse environments
mlo01210  2-Oxocarboxylic acid metabolism
mlo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mlr5943
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mlo01007]
    mlr5943
Enzymes [BR:mlo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.76  diaminobutyrate---2-oxoglutarate transaminase
     mlr5943
Amino acid related enzymes [BR:mlo01007]
 Aminotransferase (transaminase)
  Class III
   mlr5943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: BAB52304
RhizoBase: mlr5943
UniProt: Q98AL8
Position
4807200..4808459
Genome map
AA seq 419 aa AA seqDB search
MDIDIFAAYESNVRRYGRSFPTVFKKSLGATIWDESGKPYIDFLVGSGALNYGHNNPDII
EPAIQYLADQNIVLSLDMYTAAKRDFIEVFVESILKPRGLSYKIQFPGPTGTNANEAALA
LARKYTGRSSVMAFTNSYHGMSLGSLAVSGSASTRQLGGVARHDVIRVPYENYPNQTFDS
ASYIDHVLGDPGSGIEKPAAIILEPIQAEGGMNTASAPWLSEIQRICRKHDVVFIVDDIQ
AGSGRTGDFFSFEFAKIEPDIVCLSKSLSGSGNPLSIVLIRPDMDIWNPGEHSGTFRGNN
LAFVTSAAMCKMWSDRQFTTAVERTAVKLQEHLDRLVAKYPKCIEQKRGRGLMAGLKCRS
QAVVGRVHDVAFENGLLIESSGPNRDVIKVLPPITISDDELDHGIAILDQALQEKTNGD
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgacattttcgcagcctacgagtctaacgttcgtcgctatggacgatcgttt
ccaacagtctttaaaaagtcgcttggggcgacaatctgggacgagtccggaaagccatat
attgatttccttgtagggtcaggcgcgctcaactacggtcataacaacccggatattatt
gaaccggcaattcaatatctcgccgatcaaaatatcgtcttgtcgcttgatatgtataca
gctgcaaagcgtgatttcatcgaagtgtttgtcgagtcgatcctgaagccccggggcctt
tcttacaagatacagtttcctgggccgaccgggacgaacgctaacgaagcggcgttggcg
ctggcgcgaaaatataccggccgctcgagtgtcatggccttcacaaattcgtaccatggc
atgtcgctcggctccttggcggtgtcgggttcagcgtcaaccagacagcttggcggcgtt
gctcgccacgatgtgatccgagtgccttacgagaactatccgaaccaaactttcgattcc
gcgagttacattgatcacgtgttgggcgacccaggcagcgggatcgaaaagccggccgca
atcatcctggagcccatccaggcagaaggcggcatgaacaccgcatccgcaccatggctc
tcagaaattcagcgcatttgccgtaagcacgacgttgttttcatcgtcgatgacattcag
gcaggttcgggacgaacgggcgatttcttctcattcgagttcgcgaaaatcgagcccgac
atcgtgtgtctttcgaaatcgctaagcggttcaggtaatccgttgtccatagttctgatt
cgccccgacatggacatatggaatccgggggaacatagcgggaccttcagaggcaataat
ctcgcctttgtgacttccgcggccatgtgcaaaatgtggtccgataggcagtttactacc
gccgtcgagcggactgccgtcaaactgcaagaacaccttgatcgcctcgttgcgaaatac
cccaagtgcatcgaacaaaagcgcggccgtggtctgatggccggcctcaagtgccgttca
caggccgttgttggccgtgtgcacgatgtcgcgttcgaaaacggcctgctgatcgaatcc
tcggggccaaatcgcgacgtcatcaaagtccttccgccgataaccatctcagatgacgaa
ctcgatcatggcattgccatcctcgatcaggcactacaggagaaaacaaatggcgattaa

DBGET integrated database retrieval system