KEGG   Mesorhizobium japonicum MAFF 303099: mlr5973Help
Entry
mlr5973           CDS       T00043                                 

Definition
(GenBank) integrase/recombinase
  KO
K07497  putative transposase
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    mlr5973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase HTH_21
Motif
Other DBs
NCBI-ProteinID: BAB52333
RhizoBase: mlr5973
UniProt: Q98AJ6
Position
4834291..4835154
Genome map
AA seq 287 aa AA seqDB search
MRFAFIARHRNIWPVAWLCDALDVSRSGFHAWLNRSPSARSRHDEVLVAQIDRSFKSSDR
TYGARRVWHDLLAEGLSCGLHRIERLMRENGLRARPRRRGLPKDTGERAAVSDNLLDRAF
QVHLVSTGISWPALNQTVCALRFFCGVTLGHAEIPERIAYARAPRTLPVVLSADEVVRFL
EAVPSLKTRTALTTAYAAGLRASETVGLKVSDIDSERGVIRVEHGKGGKDRTVMLSAQLL
RILRVYWRLAKPKGWLFPGRMQIAPSTFRYCTRPAARRVQPPASTSA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcgctttcatcgcgaggcaccggaacatctggccggtggcgtggctgtgcgac
gcgctggacgtatcccgctcaggcttccatgcctggctcaaccgcagccccagcgctcgc
tcccggcacgacgaggtgctcgtcgcccagatcgaccgaagcttcaagagcagcgaccgc
acctatggcgcccgccgcgtctggcacgacttattggcggaaggcctatcttgcggtctg
catcgcatcgaacggctgatgcgggagaacggcctgcgtgcacgtccacgccgacgtggg
ctgccgaaggatacgggcgagcgagcggcagtgtcggacaacctcctcgaccgcgccttc
caggtgcatctggtctcgaccggaatctcgtggccggcgctgaaccagacggtgtgcgca
ctgcggttcttttgcggcgtgacgttgggtcatgccgagatccctgagcggatcgcctat
gcccgcgctccacgcacgctgccggtggttctcagcgccgacgaggttgtccgctttctc
gaggcggtgccgagcctgaagacgcgcaccgccttgacgacggcctatgccgccggcctt
cgcgcttcggagaccgtcgggctgaaggtcagcgacatcgatagcgaacgcggcgtcatc
cgggtcgagcacggcaagggcggcaaggaccgcaccgtgatgctgtcggcgcagcttctg
cgcatcctgcgcgtctactggcggctggcgaagccaaagggctggctgtttccgggccgg
atgcaaatcgccccatcgacgttcaggtattgtactcggcctgccgctcggcgcgtgcag
ccgccggcatcgacaagcgcgtga

DBGET integrated database retrieval system