KEGG   Mesorhizobium japonicum MAFF 303099: mlr6401
Entry
mlr6401           CDS       T00043                                 
Name
(GenBank) conjugal transfer protein; TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    mlr6401
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mlo02044]
    mlr6401
Secretion system [BR:mlo02044]
 Type IV secretion system
  Trb secretion system protein
   mlr6401
SSDB
Motif
Pfam: DUF4141 HDAC4_Gln DUF3253 DUF2150
Other DBs
NCBI-ProteinID: BAB52705
RhizoBase: mlr6401
UniProt: Q989J1
Position
5224586..5225311
AA seq 241 aa
MMRRRFLSGLITLSLIAKPMADYVQPAYALIVFDPSNYAQNVLTAARSLEQINNQIQSLQ
NQATVLQNMARNLQGLDFSSVGQLTGSLQRIDGLMDQASGLSFDLNKLQDQWRNQYPESY
DATIKVSDVASAARDRWQSAMQAFRQTMGVQSQIVENVRGDGDLLADLVNRSQGAAGALQ
ASQATNQLLALSTKQQMQIQTLLATQFRAEAEDAARKAQSEEAARETTKRFLGTGRAYPG
N
NT seq 726 nt   +upstreamnt  +downstreamnt
atgatgcggcgccgctttctctcgggcctgatcaccctttcgttgatcgccaagccgatg
gccgactacgtgcagccggcctacgcgctcatcgtgttcgatccgtcgaactacgcacag
aacgtgctcacggcggcgcgctcgctggagcagatcaacaaccagatccagtcgctccag
aaccaggcgaccgtgctgcagaacatggcacgcaatcttcagggtctggatttttcttcc
gtgggtcagcttaccggctcgctccaacggatcgacggtctgatggaccaggcgagtggc
ctgagctttgatctcaacaagcttcaggaccagtggcgtaatcaatatccggaaagctac
gacgccacgatcaaggtcagcgatgtggcgagcgccgcacgtgaccgctggcaaagcgca
atgcaggcattccgtcagaccatgggtgttcagtcgcagatcgtcgagaatgttcgcggt
gatggtgacctgcttgccgatctcgtcaaccgcagccaaggcgcggccggtgcgcttcag
gcaagtcaggccactaaccagctccttgcgctttcgaccaagcagcagatgcagatccag
acgctgctcgcaacgcagttccgcgctgaggccgaggatgcggcgcgcaaggcgcagtcc
gaggaggccgcgcgcgagacgacaaagcgcttcctcggcacaggcagggcctatcccggc
aactga

DBGET integrated database retrieval system