KEGG   Mesorhizobium japonicum MAFF 303099: mlr6405
Entry
mlr6405           CDS       T00043                                 

Definition
(GenBank) conjugal transfer protein; TrbI
  KO
K20533  type IV secretion system protein TrbI
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    mlr6405
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mlo02044]
    mlr6405
Secretion system [BR:mlo02044]
 Type IV secretion system
  Trb secretion system protein
   mlr6405
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: BAB52709
RhizoBase: mlr6405
UniProt: Q989I7
Position
5228413..5229642
AA seq 409 aa
MKGNFMTDTSRPNTPPKLDPEQLQLRASPRRAVRFRRGVIIAIAAVGSGAILGVTMMALQ
GPAWRIKHQAEDRYNTERKPPAEGLEALPKDYSGIMPKAPVLGPPLPGDLGRPILERQRQ
LGIAPGQDISAEEQRLAQQAIEARESQVLFRIDNRPRQTDVAGGGPSAQQPSEALPQSGA
TRTSASVAPAEGDQNNQQRKLDFVSQRNTSGIYNPHALQTPASPYQLMAGSVIAASLVTG
INSDLPGLVVAQVTENVHDTVTGSIVLIPQGSRLIGTYDSVVAFGQRRALLVWQRIILPD
GSSIEIDNLPATDTAGYAGLEDKVDFHTWQLIKGVALATLLGVGTELSFGENESDLVKAI
RESTQQNISQAGQRITEKNLNIQPTIIVRPGWPLRVIVHKDLVLRPYPT
NT seq 1230 nt   +upstreamnt  +downstreamnt
gtgaaggggaacttcatgaccgatacgtcccgccccaatacccctccaaaactcgatccc
gagcagctgcagttgcgagcctcgccccgccgcgctgtccgattcaggcgcggtgtgatc
atcgccatcgctgcagtcggatccggtgccattctgggcgtcacgatgatggcgcttcaa
ggaccggcatggcgtatcaagcaccaggcagaggaccgctataacaccgagcgcaagcca
cccgccgagggactagaagcgcttcccaaggactattccgggatcatgccgaaggcccct
gtgctcggaccgccactgcccggcgacctcggtcgccccatccttgaacgccaacgtcag
ctcggcatcgcgccagggcaggatatctccgccgaggagcagcgccttgcccagcaagca
attgaggcgcgcgagtcgcaagtcttgttccggatcgacaatcgacccagacagacagat
gtcgccggaggcgggccgagtgcgcagcagccgtctgaggcgcttccgcaatccggagcg
acgcgcacgtcagcttccgttgccccagccgagggtgaccagaacaaccaacagcgcaag
ctcgattttgtcagtcagcgaaacacaagcgggatctacaatccgcatgcgctgcagacg
ccggcctcgccctaccaactgatggccggcagcgtgatcgcggccagtctcgtcaccggc
ataaattccgacttgcctggccttgtcgtcgcgcaggtcaccgagaatgtgcacgacaca
gtcaccggcagcattgtgctcattccgcaaggctcacgcctcatcggcacttatgacagc
gtcgtggcttttgggcagaggcgcgcattgctggtctggcagcgaataatcctgcccgac
ggttcctcgatcgaaatcgacaatctgccagcgacggatactgccggctatgctgggctt
gaagacaaggtcgattttcacacctggcagctgatcaagggagttgctctagcgacgcta
ctgggcgttggtaccgagttgagctttggggaaaacgaaagcgacctagttaaggcgatc
cgggaatccactcagcaaaacatcagtcaagccggccagcgcatcaccgaaaagaacctg
aatattcaacccaccattatcgtccgccccggttggcccctacgcgtgattgtacacaag
gatcttgtgctgcgcccatacccgacttga

DBGET integrated database retrieval system