KEGG   Mesorhizobium japonicum MAFF 303099: mlr6787Help
Entry
mlr6787           CDS       T00043                                 

Definition
(GenBank) putative hydrolase
  KO
K18614  2-(acetamidomethylene)succinate hydrolase [EC:3.5.1.29]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00750  Vitamin B6 metabolism
mlo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    mlr6787
Enzymes [BR:mlo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.29  2-(acetamidomethylene)succinate hydrolase
     mlr6787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Esterase Ndr
Motif
Other DBs
NCBI-ProteinID: BAB53016
RhizoBase: mlr6787
UniProt: Q988D4
Position
5586860..5587696
Genome map
AA seq 278 aa AA seqDB search
MDMAADIASDHFISRRVDIGRITLNVREKGSGPLMLFFHGITSNSAVFEPLMIRLSDRFT
TIAVDQRGHGLSDKPETGYEANDYADDIAGLIRTLARGHAILVGHSLGARNSVTAAAKYP
DLVRSVVAIDFTPYIETEALDALEARVNAGSQLFEDIKAVEAYLAGRYPNIPADAIRIRA
ESGYQPVDGGLRPLASSAAMAQTARGLRSDLVPAYRDVTKPVLIVRGESSKLVSAAALAK
TSRLRPDLPVVVVPGADHYVNEVSPEITLKAITNFIDA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggacatggcggcagacatagcttccgaccacttcatctcgcgacgcgtcgacattggc
cgcatcaccttgaacgtgcgcgagaagggcagcggtcccctgatgctgttcttccacggc
atcacctccaactccgccgtcttcgaaccgttgatgatccggctttcggaccggtttacg
acgattgcggttgaccagagggggcatggcctcagcgacaagccggagacgggctacgag
gcgaatgactacgcggacgacatcgccggcctgatacgcacgctcgctcggggccatgcc
atcctcgtcggacattcgcttggtgctcgaaattcggtcacggccgcggcgaaatacccg
gatctggtgcggtcggtcgtcgcgatcgactttacgccgtacatcgagaccgaagcgttg
gacgcgctggaagcgcgcgtgaacgcggggagccagcttttcgaggatataaaggccgtc
gaagcatatctcgccggccgctacccgaacattcccgccgatgccatcaggatcagggct
gaaagcggctatcagccggtcgacggcggattgcgtccattggcgtcgtccgcggccatg
gcgcagaccgccaggggcctgcgatcggatttggtgcccgcctaccgcgacgtgacgaag
cccgtcctcatcgttcggggcgagtcgagcaagttggtttctgcggcggcgctggcgaag
acaagccggctgcggcccgatctgcctgtcgtcgtcgttccgggcgccgaccactacgtc
aacgaggtatctcccgagatcacgttgaaagccatcaccaacttcatagacgcctga

DBGET integrated database retrieval system