KEGG   Mesorhizobium japonicum MAFF 303099: mlr7551Help
Entry
mlr7551           CDS       T00043                                 

Definition
(GenBank) dTDP-6-deoxy-D-glucose-3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00521  Streptomycin biosynthesis
mlo00523  Polyketide sugar unit biosynthesis
mlo01130  Biosynthesis of antibiotics
Module
mlo_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    mlr7551
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    mlr7551
Enzymes [BR:mlo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     mlr7551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: BAB53987
RhizoBase: mlr7551
UniProt: Q985S5
Position
6232935..6233486
Genome map
AA seq 183 aa AA seqDB search
MEIRSLGIDGVLEIVPKRHGDARGFFMETYNAERFSQAGIDLVFVQDNHSYSATAGVLRG
LHYQLEPRAQDKLLRVIRGSILDVAVDIRRGSKTFGKWVACEISAEKGNQILVPKGFAHG
FVTLVPDTEVLYKVTDTYSPEHDRSVRFDDPVIGIEWPSVAGGFQLSDKDLKAPVLAEAE
VFA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttggagatcaggtccctcggcatcgatggcgtgctggaaatcgttcccaagcgacatggc
gatgcacgcggcttcttcatggaaacctacaatgccgagcggttttcgcaggcaggcatc
gacttggttttcgtgcaggacaaccattcctattccgctacggcaggcgtcttgcgaggg
cttcactaccagctcgagccgcgggcccaggacaagctgctgcgcgtcattcgcggcagt
atcctcgacgttgcggtcgatatccgccgtggttcgaaaacctttgggaaatgggtcgcc
tgcgagatttcggccgaaaagggcaatcagatcctggtgccaaagggtttcgcgcatggc
tttgtgacgctcgtgcccgacaccgaggttctctataaggttaccgacacttattcgccc
gagcacgatcggtccgtccgcttcgacgatcccgtcatcggcatcgaatggccttcagtg
gctggcggattccagctttcggacaaggacctcaaggcgccggtgctcgccgaggccgaa
gtgtttgcctga

DBGET integrated database retrieval system