KEGG   Mesorhizobium japonicum MAFF 303099: mlr7614Help
Entry
mlr7614           CDS       T00043                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00071  Fatty acid degradation
mlo00072  Synthesis and degradation of ketone bodies
mlo00280  Valine, leucine and isoleucine degradation
mlo00310  Lysine degradation
mlo00362  Benzoate degradation
mlo00380  Tryptophan metabolism
mlo00620  Pyruvate metabolism
mlo00630  Glyoxylate and dicarboxylate metabolism
mlo00640  Propanoate metabolism
mlo00650  Butanoate metabolism
mlo00900  Terpenoid backbone biosynthesis
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01120  Microbial metabolism in diverse environments
mlo01130  Biosynthesis of antibiotics
mlo01200  Carbon metabolism
mlo01212  Fatty acid metabolism
mlo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    mlr7614
   00630 Glyoxylate and dicarboxylate metabolism
    mlr7614
   00640 Propanoate metabolism
    mlr7614
   00650 Butanoate metabolism
    mlr7614
  09103 Lipid metabolism
   00071 Fatty acid degradation
    mlr7614
   00072 Synthesis and degradation of ketone bodies
    mlr7614
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    mlr7614
   00310 Lysine degradation
    mlr7614
   00380 Tryptophan metabolism
    mlr7614
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    mlr7614
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    mlr7614
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    mlr7614
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mlo04147]
    mlr7614
Enzymes [BR:mlo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     mlr7614
Exosome [BR:mlo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   mlr7614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: BAB54041
RhizoBase: mlr7614
UniProt: Q985M1
Position
6305261..6306439
Genome map
AA seq 392 aa AA seqDB search
METAMTACIVGWAHSRFGKLEGETLENLIVKVATDALDHAGIGPDEVDEIVLGHFNAGFS
AQDFTASLVLQADDRLRFKPATRVENACATGSAAVRQGIRAIDANAARIVLVVGAEQMTT
TPGPEIGKNLLKASYLPEDGETPAGFAGVFGKIAQAYFQRYGDQSDALAMIAAKNHKNGV
DNPYAQMRKDFGYDFCRQESEKNPFVAGPLKRTDCSLVSDGAAALILADTATALKMRRAV
AFRANEHVQDFLPMSKRDILAFEGCEQAWTRALKNAGVTLDDLSFVETHDCFTIAELIEY
EAMGLARPGEGAKLALDGTTAKDGRLPVNPSGGLKAKGHPIGATGVSMHVLTAMQLVGEA
GGIQVPGAKLGGIFNMGGAAVANYVSILDRIR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgccatgaccgcatgcatcgttggctgggcgcattcgcgcttcggcaagctc
gagggcgagacgctcgaaaacctcatcgtcaaggtcgcgacggatgcgctcgaccatgcc
ggcatcggtccggacgaggtcgacgagatcgtgcttggccatttcaacgccggcttctcg
gcgcaggatttcaccgcgagcctggtgctgcaggccgacgaccggctgcgcttcaagccg
gcaacgcgcgtcgagaacgcctgcgcgacgggatcggcggcggtccggcaaggcatccgc
gccatcgacgccaacgcggcccgcatcgtgctggtggttggcgccgaacagatgacgacg
acgccgggacccgagatcggcaagaaccttctgaaagcgtcctatctgccggaggacggc
gagacacccgcgggcttcgccggcgtcttcggcaagatcgcgcaggcctatttccagcgt
tatggcgaccagtccgatgcgctcgccatgatcgccgccaagaaccacaagaacggcgtc
gacaatccctatgcgcagatgcgcaaggatttcggctatgatttctgccggcaggagagc
gagaagaaccccttcgtcgccggtcctctcaagcgcaccgactgctcgctggtctccgac
ggcgccgccgctcttatcctcgccgatacggccactgcgctgaagatgcgccgcgcagtt
gccttcagggccaatgaacatgtgcaggatttcctgccgatgtcgaagcgcgatattctg
gccttcgaaggctgcgagcaggcttggacccgcgcgctgaagaatgccggcgtgacgctc
gacgatctgtcctttgtcgagacgcatgactgcttcaccattgccgaactgatcgaatat
gaggccatgggcctggccaggcccggcgagggcgcgaagctggcgctggatggcacgacg
gccaaggacggccgccttccggtcaacccctccggcgggctcaaggccaagggccacccg
atcggcgccaccggtgtctccatgcatgtcctgaccgccatgcagcttgtcggcgaagcc
ggcggcattcaggtgccgggcgcgaagcttggcggcatcttcaacatgggtggcgcggcg
gtcgccaactacgtttccattctcgaccggatcaggtaa

DBGET integrated database retrieval system