KEGG   Mesorhizobium japonicum MAFF 303099: mlr7821Help
Entry
mlr7821           CDS       T00043                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00564  Glycerophospholipid metabolism
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
Module
mlo_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    mlr7821
Enzymes [BR:mlo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     mlr7821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: BAB54203
RhizoBase: mlr7821
UniProt: Q984W0
Position
6470049..6470747
Genome map
AA seq 232 aa AA seqDB search
MSLVDTVKNAFVPIHREGYPFIAACGAGTLFLGYFSSVLFWLGLILTAWCVYFFRDPERV
TPVDDRLVVSPADGIISAVGPAVPPRELGLGNVEMTRISVFMNVFSCHVNRSPVRGRIAK
IEHRPGKFLNAELDKASTENERNGLVIESPNGTVAAVQIAGLVARRIVCWAEAGGSIGTG
ERFGLIRFGSRVDVFLPLTATPRVAVGQTAVGGETVLAEFGGVAGTPLVRIS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagccttgtcgacacggtcaagaacgcgttcgtaccgatccatcgcgaaggctatccc
ttcatcgcggcctgtggcgcgggtacgcttttccttggctatttctcctcggtcctgttc
tggctcggcctgatcctgacagcctggtgcgtctatttcttccgcgaccccgagcgggtt
acgccggtagacgaccgcctggtggtgagccccgccgatggcatcatttcggctgtagga
ccggccgtgccgccgcgcgagcttggcctcggcaatgtcgagatgacccgcatctcggtg
ttcatgaacgtcttttcctgccatgtgaaccgctcgcccgtgcgcggccgtattgccaag
atcgaacatcggccgggaaaattcctcaacgccgaactcgacaaggccagcaccgaaaac
gaacgcaacggcctggtcatcgaaagccccaacggcacggtggcggccgtccagatagcc
ggcctggtggcgcgccgcatcgtctgctgggccgaggccggcggctcgatcggcacaggc
gagcgtttcggcctgatccgcttcggctcgcgcgtcgacgtgttcctgcccttgaccgcg
acgccacgcgtcgccgttggccagacggcggtcggcggtgaaaccgtgctcgccgaattc
ggcggcgtcgccggcaccccgctggtcaggatttcctga

DBGET integrated database retrieval system