KEGG   Mesorhizobium japonicum MAFF 303099: mlr9250
Entry
mlr9250           CDS       T00043                                 

Definition
(GenBank) conjugal transfer protein
  KO
K03198  type IV secretion system protein VirB3
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    mlr9250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mlo02044]
    mlr9250
Secretion system [BR:mlo02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   mlr9250
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: BAB54633
RhizoBase: mlr9250
UniProt: Q981S6
Position
pMLa:229432..229740
AA seq 102 aa
MADGRIDPGEPKLLITPLVKGLTRAPTVLGIPYELAGFIGVLTAVVFLATHNLLMLCICV
PLYAVARIAIMRDSMFIEIMFIRSRKTPPRSASFWGARSYRV
NT seq 309 nt   +upstreamnt  +downstreamnt
atggcagacggccggatcgatcctggcgagcccaaattgttgatcactccgctcgtcaag
ggcttgacccgagcgccgacggtgctcggcattccctacgagcttgccgggttcatcggc
gtgctgacggcggtcgtgttcctcgcaacccataatctgctcatgctctgtatctgcgtg
ccgctctatgcggtcgccaggatcgcgatcatgcgcgattccatgttcatcgagatcatg
ttcatccgttcacgaaagacgccaccccgaagcgccagcttctggggtgcgcgcagttat
cgggtgtga

DBGET integrated database retrieval system