KEGG   Mesorhizobium japonicum MAFF 303099: msr5947Help
Entry
msr5947           CDS       T00043                                 

Definition
(GenBank) transposase
  KO
K07497  putative transposase
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    msr5947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_21
Motif
Other DBs
NCBI-ProteinID: BAB52308
RhizoBase: msr5947
UniProt: Q98AL5
Position
4810420..4810710
Genome map
AA seq 96 aa AA seqDB search
MRPGRKRELVADTCTEWNVSIRRACRVLEFDTSTYHYKSRRRDQAGIEARIKDICATRVR
YGYRRVHVMLTREGWDINMKRTYRIYRDLGRRLITA
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcctggtcgcaaacgcgagctggtggcggatacctgtactgagtggaacgtgtcg
atccggcgtgcctgccgggttctggagttcgacacatcgacctatcactacaagtcccgt
cgccgcgatcaggccggcatcgaagctcggatcaaagacatttgtgcaacgcgggttcgt
tatggctaccggcgcgtgcacgtgatgctcacgcgcgagggctgggacatcaacatgaag
cggacctatcggatttacagggacttaggacgtagactcattaccgcgtag

DBGET integrated database retrieval system