KEGG   Mycobacterium lepraemurium: MLM_2022Help
Entry
MLM_2022          CDS       T05534                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
mlp  Mycobacterium lepraemurium
Pathway
mlp00471  D-Glutamine and D-glutamate metabolism
mlp00550  Peptidoglycan biosynthesis
mlp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    MLM_2022
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MLM_2022
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mlp01011]
    MLM_2022
Enzymes [BR:mlp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     MLM_2022
Peptidoglycan biosynthesis and degradation proteins [BR:mlp01011]
 Precursor biosynthesis
  Amino acid ligase
   MLM_2022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C TrkA_N XdhC_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ATA28507
UniProt: A0A250BQV2
Position
1982483..1983952
Genome map
AA seq 489 aa AA seqDB search
MSAAEPALAPLSPGVPVLVAGGGITGRAVLAALRRFGAAPTLCDDDPATLRGYADSGADT
VATSAAAERISRYALVVTSPWFAPTAPLPLAAAAAGVPVWGDVELAWRLDAAGHYGPPRR
WLVVTGTNGKTTTTSMLHAMLTAAGRRSLLCGNIGSPVLDVLDQPAELLAVELSSFQLHW
APSLRPEGGAVLNIAEDHLDWHGTLADYAAAKARVIDGRVAVVGLDDSRAAALLSTARAP
VRVGFRLGEPAAGELGVRGGQLVDRAFAGDLTLLPVDSIPVPGPIGVLDALAAAALARCV
DVPASPIADAIASFRVGRHRAEVVAVADGISYVDDSKATNPHAAEASVLAYPRVVWIAGG
LLKGASVDAEVARMASRLVGAVLIGRDRREVADALSRHAPDVPVVHVVTGEDAGMDATPV
VFGANVTKVKYLGGDLGAAVMSAAVAAARDLAKPGDTVLLAPAGASFDQFAGYAGRGDAF
AAAVRAAIR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgctgagccggccctggccccgctgtcgccgggggtgccggtgttggtggcc
ggcggcgggatcaccggcagggcggtgctggcggcgctgaggagattcggcgcggcgccg
accctgtgcgacgacgaccccgccaccttgcgcgggtacgccgattcgggagccgacacc
gtcgccacatcggcggccgccgaacggatttcgcgctatgccctggtggtcaccagcccc
tggttcgcgccgaccgcaccgctaccgctggccgccgccgcggcgggggtgcccgtgtgg
ggggacgtggagctggcctggcgcctcgacgccgccggccactacgggccgccgcgccgc
tggctggtggtcaccgggacgaacggcaagaccaccaccacgtcgatgctgcacgccatg
ctgaccgcggcaggccggcgaagtctgttgtgcggcaacatcggtagcccggtgctcgac
gtgctcgaccaacccgccgagctgctggccgtcgagctgtccagcttccaactgcattgg
gcgccctcgctgcggccggaggggggggcggtgctcaacatcgccgaagaccacctcgac
tggcacggcacgctggccgactacgccgcggccaaggcccgggtgatcgacggccgggtg
gccgtcgtcgggctggacgacagcagggccgcggcgctgctgagcaccgcccgggcgccg
gtgcgggtcggtttccggctgggcgagccggccgccggggagctcggtgtgcgcggcggc
cagctcgtcgaccgcgccttcgccggcgacctgaccctgctgccggtcgactcgatcccg
gtgcccggacccatcggagtgctcgacgccctggccgccgccgcgctggcgcgctgcgtg
gacgtgcctgcatcgcccatcgccgacgcgatcgcctccttccgtgtgggtcggcaccgg
gccgaggtggtggccgtcgccgacgggatcagctacgtcgacgactccaaggccaccaat
ccgcacgccgccgaggcctccgtgctggcctatccccgggtggtgtggatcgccggcggg
ctgctgaagggcgcgtcggtcgacgccgaggtggccaggatggcgtcccggctggtcggc
gcggtgctcatcggccgagatcggcgagaggttgcagacgcgttatcgcgacacgcgccg
gatgtccccgtcgtccacgttgtgacaggcgaggatgctggtatggatgcgacgcctgtg
gtttttggtgccaatgtgacaaaagtgaaatatttgggcggggatctcggcgctgcggtc
atgagcgcggcggtggccgccgcccgtgacctggccaagcccggtgacaccgtcctgctg
gcaccggcgggcgcgtcgttcgaccaattcgccgggtacgccggccggggcgacgcgttc
gcggccgccgtgcgcgcggccatccggtag

DBGET integrated database retrieval system